SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340501666|gb|EGR28421.1| from Ichthyophthirius multifiliis strain G5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340501666|gb|EGR28421.1|
Domain Number 1 Region: 15-161
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000595
Family APC10-like 0.025
Further Details:      
 
Domain Number 2 Region: 426-653
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000797
Family GUN4-associated domain 0.079
Further Details:      
 
Weak hits

Sequence:  gi|340501666|gb|EGR28421.1|
Domain Number - Region: 197-230
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.000445
Family C-terminal UvrC-binding domain of UvrB 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340501666|gb|EGR28421.1|
Sequence length 849
Comment hypothetical protein IMG5_176070 [Ichthyophthirius multifiliis]
Sequence
MSKQDTQNQNCQKLAYRILSCSSEEPSNPVMELLTQSPQSKGWQSSRFCDYPQEILFQFM
SPVRLKQLQFLSHQSKISSRIEIYIYMPNQNAPFINTDIKYKKLGYLSLDSNERTGYQSR
ELKTVYVDAPCLYLKLIFNKQHNNKYNMFNQVGIIALSAFGELLTNQQQNSTNNKQQKQY
YNQIQHQTQYDAITLDRLRTLETAKEQAVQNEDFEEAKRLKDAIERLKQIGTQLRQLDER
KQIAIQNEDYESAKIIKAEIERLRNAIAPEYILQKPGPINYPQTNQQQQFQRSYIQLQQQ
QIQQQQQQQQQQQQKQQQQQQQIIISPLQQQQFDPISQPSQNIQFQQNKDEIFLQDIKHK
KTQFLLKKFIKKINKMKNLHIKIYQYKKENIDIEQNTNPQQQQQQPEKLTNEARKLADPL
IGVIGEDYASKIFSKVWKLREDGLQELRQELQNPDKLLSKDPQEIFTAICGVCNATLGDR
VAQVLQSSMNLFQAACESQNSIPKSTKGDIQQYLDGCVGLLIEQLGQHIPKLSESAQQSL
FALGKVSIIGNAFVTNCICKGTGLKQKLQNSIKHIQGRLVILQEFVKKYQIGNKEVPLNP
VVEFSVKQLSHPNQEVRNASISLLVEIYKCVGEAKLNPFLAEVPQQQLDLLQEEFQGGKK
QENKQQKEHKVIVSTNIQHQGPSAKIKGNKKNETQGNLNNSNDKNKNTNNNNNLTNSNED
DTNKICDFCGVFNKQFIDTIKLDMHQWKECPMLMVCKYCAQVVEISSLGSHLLEECSQMR
KFRKCPRCKEPVHVDEYNTHVDEKTCLPAKGINVANRCVLCHSDIPPGQQGWKIHLTVDG
CPNNERSVG
Download sequence
Identical sequences G0R296
gi|340501666|gb|EGR28421.1| XP_004029657.1.64148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]