SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340503218|gb|EGR29830.1| from Ichthyophthirius multifiliis strain G5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340503218|gb|EGR29830.1|
Domain Number 1 Region: 318-771
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.78e-80
Family PIWI domain 0.0014
Further Details:      
 
Domain Number 2 Region: 17-339
Classification Level Classification E-value
Superfamily PAZ domain 7.85e-34
Family PAZ domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340503218|gb|EGR29830.1|
Sequence length 794
Comment paz and PIWI domain protein [Ichthyophthirius multifiliis]
Sequence
QYNYGLIPSKDTSQKFITNFYKVQINNENIYMYKFTQEFQDEELLAIIKQSYQQLSTIFE
KKFIIQRPIIISPLNISNDKLLQTKIQFGSKDQKDYMQLSLRKVQQTQLENEKQIKNIFG
LLTKTMLQDLRLEKLGKKYFEKTPCIDLKDFKMQILAGYLTSLESYQFNSKLLNIDSCFK
VTRKQTLIELIQQQNELTNITNFKGNIIITMYNNKFHRIEQIMPEMTPQDNFQDQKGNVI
TYEDYYFKQYGIQNINPKQPLIKCIKLIGKTKKPFEYYLIPSLCYVTGIFLFIKKYINRL
TNQQKSDFHLMKKLAETTKPNAQIRQNQQLKFVKQLRTDCDRRMKDWNININEIPEKINF
KQLSPGNLLMDQTPNCKKAFNVLNCNLDRDTQTKMFEQPALKKWAIFYYKDDQQIFNKLT
NMFQECLKFCQYPCQAPFSVKVDENTANGWINVLKSSPDDAQMCVILLRGKKKSGQFYDQ
IKLFLTNQKPIPSQVILTSTASNDKGLRTVVNKLLVQICSKTGGIPWVMSDMPFQDQPTM
IVGIDVYHNISGKQQSILGFVATTNVHFTKYYSSSVMMQQGQEISQYLQQIYVNALKQFN
KFNGIYPKRVIVFRDGISQGQFKVIQEIEMPQLNQAIKQIQECGDIKFCIISVNKVNYLF
ILYKKKICQNPPQGALIENLITKGDHDFYIVSQKAYQGTSSPTHYYIVYNDIIPFELQKL
EFREYIQFKRELQLLAFKSTFLYYNYSGAIKEPSAVRYAHVLCNFVGQKYNPSVPNSLIQ
AHQQYDNLQSLYFI
Download sequence
Identical sequences G0QY91
XP_004031066.1.64148 gi|340503218|gb|EGR29830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]