SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340505002|gb|EGR31382.1| from Ichthyophthirius multifiliis strain G5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340505002|gb|EGR31382.1|
Domain Number 1 Region: 343-791
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.8e-70
Family PIWI domain 0.016
Further Details:      
 
Domain Number 2 Region: 36-366
Classification Level Classification E-value
Superfamily PAZ domain 6.59e-38
Family PAZ domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340505002|gb|EGR31382.1|
Sequence length 791
Comment PIWI domain protein [Ichthyophthirius multifiliis]
Sequence
MTSRPKKSGAKVGIPKKLISNCYPIEQLKKTINSQDLVCFQYDVQFIPEIEADNRDLRYK
IFQCAKSQIEYLIGKFSFSGQSLYILKELNQENINKVNTIPNIKDNNTTYQLRLKLVQKF
TFNEAEAMNEGSLVQKKSNRVIQLINIIIKDAMRQQLNFKEIGRNSKFFDTSQDYTINAF
KILKGTTCSVQPSVSGLNLRVDYACRVLQTETALQVIMKIQRQGTDDFKNQIKQAFQDVS
VITEYNNYQIYKIDEVDFNQSPQSLFYHKKNNTKISFENYYFQTYQIKIKDKKQPLLLSK
RKRKQGDKVIIDDIYLIPELCFMTGMTDRQRSDKTLLKQLSQYTKLDPQKRQQESSNMVK
KLAQPVKQSGILLNTQDPLVDSVQLFPPNIYFGKGILNPEKGNFDVRQPIKSPDCKFQDY
IIIYQRNDQIQADNLFNCMKKVSGSYGIQIQEPIWFEMNSNDVNVWIKQLDDDFRKNGIP
QFVISISQQSHTYNKLKDFLYNEVGLEHQNLKGSSLQKNQMSVVSKIVLQIASKLGYQLW
TTEKPKEISKNTMIIGIETSIKNVFVGKKINNVVGIVASLNPEFSKFYNEVEMRQPGDTQ
LNNLTEVIKNSLLAYKNKNKELPVEIIIYRQEQGEGQIQGSLKFEIQAIQRSFEIINKQY
QPKFAYFQVNKKITEKFYSFDQSNIIKNPNSGTIVASDQVVSKHFEFFLCAQNCNSGVCT
PTKYLCLYNSLLFKEETFWQLTYWQCFNYYNWSGPVRIPGCMMYAGKLAKFTAEVLQGCA
HENLNNSLYYL
Download sequence
Identical sequences G0QTT2
XP_004034868.1.64148 gi|340505002|gb|EGR31382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]