SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386835848|ref|YP_006250016.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386835848|ref|YP_006250016.1|
Domain Number - Region: 15-93
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00711
Family Di-heme elbow motif 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386835848|ref|YP_006250016.1|
Sequence length 109
Comment hypothetical protein SHJG_p1012 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MCGRRPPAMGRVEFCFTCWPGGPVTPPPCLRCGSNRLYYATGLCERCHPSAIPPPDSCIN
CAAWGATRNLGWLCKGCASWCRKYTTTAACTVCRHPANVAADQGSRCEP
Download sequence
Identical sequences H2KA00
gi|474987166|ref|YP_007688828.1| gi|386835848|ref|YP_006250016.1| gi|386835848|ref|YP_006250016.1|NC_017766 gi|474987166|ref|YP_007688828.1|NC_020894 WP_014677406.1.21199 WP_014677406.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]