SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386835930|ref|YP_006250098.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386835930|ref|YP_006250098.1|
Domain Number 1 Region: 505-693
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0000000194
Family Lambda integrase-like, catalytic core 0.042
Further Details:      
 
Domain Number 2 Region: 254-309
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000887
Family Cytochrome c3-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386835930|ref|YP_006250098.1|
Sequence length 766
Comment hypothetical protein SHJG_p1094 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MCLSWSVLRWTRTCHGCRAWKRTYPERGKCPRCRHETHLNTDGLCKPCLQAIRAVDDAEW
ALGGAGAQPRDLQLIVGTWRDYATHARKLVRRHNGGRRVSQAWRLKHKQEQAPTTEAAAV
LEPGFRHQLALFTVPRTLTDATVRAIIGRPLSGWDRACAVLVEMAAEHGMSQGWHYKVAE
MVRLALAVREAEGADRLPEPMLRDLPTHRDAVRLVLLRADLLEAAPEPMRFSRTDQPART
PYITDPVPIPLRAPRQCRDCHGWRPVGRRAGFRCTPCRHWRERHPRGRCVRCRREDLPLR
ADRCRTCHPYRLLDEAKPATSRATQLEISLPAGVGGPVLPVPVDVPPAADADETPAEWTA
RGQEALFTMRRDWSPVLARLRRRPRADLPLTERARLLVEEHLQLRADQQAPDYRKNIHTL
TILMYWLGAEAAVLERDVHDLAQLDPNLAAKPVCQFLRARGLLVDAPDLHQDADLVWIEA
AVGALPQPVASEVRAWVDVLRSQGRREGEFRSWDGIRRYLTYVQPVLTDWTATGVATLRE
ITQQQVEDAVNDLSGHARRQLAIVLRSLFRSLKRQRVVFRDPARNLPVGDLKGMPRSVPS
DLLAGLLDHAATPLGCLTVALAAVHAVSGHDIRAIRTADVDLARGTVEIRRGLLRHTLYL
EQFTHRLAAEWLTYRHRRWPASTNPHLLVSQKTALDPDHPAVNIGTLRGVLPKGLTLDGL
RQDRILNEALECGDPLRLMRLFGITEKTAMHYVGTAHPERTAKLPR
Download sequence
Identical sequences H2KA82
gi|474987248|ref|YP_007688910.1| gi|386835930|ref|YP_006250098.1| WP_014677487.1.21199 WP_014677487.1.57224 gi|386835930|ref|YP_006250098.1|NC_017766 gi|474987248|ref|YP_007688910.1|NC_020894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]