SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386836178|ref|YP_006241236.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836178|ref|YP_006241236.1|
Domain Number 1 Region: 854-912
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000000986
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0043
Further Details:      
 
Domain Number 2 Region: 9-76,133-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000842
Family Extended AAA-ATPase domain 0.067
Further Details:      
 
Domain Number 3 Region: 604-741
Classification Level Classification E-value
Superfamily TPR-like 0.00000976
Family Tetratricopeptide repeat (TPR) 0.064
Further Details:      
 
Weak hits

Sequence:  gi|386836178|ref|YP_006241236.1|
Domain Number - Region: 509-562
Classification Level Classification E-value
Superfamily LigB-like 0.0523
Family LigB-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386836178|ref|YP_006241236.1|
Sequence length 928
Comment LuxR family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPPLESPRRHITGLVGRRYELSVVERLVAPTRHGAPGTLFVGEPGVGKTALLDAAEDAAV
RRGVRVLRAAGVEVEADLPYAGLHQLLLPLHEELSHLQKDLRTALRAALGLEDAPVRDQL
LVCNATLTLLVNAARGPGLLVIVDDLHWMNPTSAGVVAFVARRLGAGRLSLLAAGRTEAE
KALRPLGIRMHQLTPLNEAESDDLLNAHHPDLDGATRRRVLNEARGNPLALLELPTALTW
TGVESDSFATTPVTRRIQDLYAARLEGASDLGRRLLLLAALDATGDCRLLSITDSQAEAM
EALAKAERDRLIEFDSQSGRLTFPHPLIRSTIITLASGADRRWAHNRLASLFDGQPDRQV
WHLAAAAVAPDSEIAGLLEQTGHRSFRRGDGAGATSAFMHAARLSTDPGESSRRLALAAY
ARGHISGELRQSSRMLVEMRRMSSLPPLHGALACAHQLLNSDGDVDAAHRLLTTALLNAR
LEEDDYPSTTAEALYLLMMCAFFGGRGELWQPVRVLLGELGSRTPPAIALSWGTLADPAR
ASARALKELDMALGGLTESADPSHIVRVALAAAFVDRLPDCRSALRQVARAGLEGQAPVL
GLNAQMLLGRDLFWTGGWDEATKTIDDAVALCLSSGYLILSTPGRYAQGMLASLRGDYDT
AEAIAEELMGWAGPRNIRLIECYGRHIRALAALSRGDYENAYRQTASIVPPGALPPHAPH
ALVTQLDLVEAAIRTGRHAEAAAHATALVEAGVRTISSRQALVTDAVAALVAPEEMTRLR
FDETLALPEVGRWPFDLARVQLLYGERLRRMRAVQESRAQLRAALETFQRLRAQPWVERA
ANELRATGEGETIHSFDSHEVLTHQERLIAQLAASGLTNKQIGERLSLSPRTVSGHLYHL
FPKLGISSRAALRDALDSQVHHEPPAST
Download sequence
Identical sequences H2K4H7
WP_014668732.1.21199 WP_014668732.1.57224 gi|386836178|ref|YP_006241236.1| gi|474978618|ref|YP_007689084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]