SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386841181|ref|YP_006246239.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386841181|ref|YP_006246239.1|
Domain Number 1 Region: 163-375
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-54
Family Prokaryotic proteases 0.0000109
Further Details:      
 
Domain Number 2 Region: 363-471
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-17
Family HtrA-like serine proteases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386841181|ref|YP_006246239.1|
Sequence length 478
Comment protease (secreted protein) [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MSTENEGNAVPPAPSAPPVPMASPAASPQGPAPEGNAPTAPLPPVPHEAPAASAAADHGP
AYQGGPAPDGSWPPPPPATPAYADGGSGGAGADWGSTYQQPVPKQRGGRGGLVAAVLVAA
LVAGGLGSGLGYTLAKDRDDRGSTTVSASDGGVTQVKRAPGTIAGVASKALPSTVTIEAE
STDGEGGTGTGFVFDTQGHIVTNNHVVADAVDGGKLTATFPNGKKYDAEIVGHAQGYDVA
VIKLKNAPSDLKPLALGDSDKVAVGDETIAIGAPFGLSNTVTTGIISAKNRPVASSDGSS
SSKASYMSALQTDASINPGNSGGPLLDASGAVIGINSAIQSTGSGGFGTGQSGSIGLGFA
IPINQAKYVAQQLIKTGKPVYARIGASVSLTDSSDGAQITDQGTGGSAAVETGGPADKAG
LKPGDVITKLDDHVIDSGPTLIGEIWTHKPGDKVTVTYKRGGQEHTVDLTLGSRVGDN
Download sequence
Identical sequences H2K1W5
WP_014673685.1.21199 WP_014673685.1.57224 gi|386841181|ref|YP_006246239.1| gi|474983392|ref|YP_007693858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]