SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386842632|ref|YP_006247690.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842632|ref|YP_006247690.1|
Domain Number 1 Region: 92-228
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.45e-24
Family GntR ligand-binding domain-like 0.012
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.35e-23
Family GntR-like transcriptional regulators 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386842632|ref|YP_006247690.1|
Sequence length 230
Comment GntR family transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MPLGALRPSPLVEQAAQRLRDQITAGHWPVGTKLPGETTLARELGVGRSTVREALRALAG
AGLVRPRHGAGVFVIATEPAEDWPARLRRAAVTDVYEVRMGVEVQAARLAARRRTDEDVT
ALRAALEDRRTAAAGDDAGFVDADIALHAAVVAAAHNPVLTGLFTEFLPVLREGLVTLLD
LTRLREEDPGTGDDTHAALVHAIAGADPDRAAAVLLTELERTLELLRERG
Download sequence
Identical sequences A0A117QEY2 H2K7J2
gi|474984841|ref|YP_007695307.1| gi|386842632|ref|YP_006247690.1| WP_014675110.1.21199 WP_014675110.1.28171 WP_014675110.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]