SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386842871|ref|YP_006247929.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842871|ref|YP_006247929.1|
Domain Number 1 Region: 38-280
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000253
Family APH phosphotransferases 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386842871|ref|YP_006247929.1|
Sequence length 299
Comment phosphotransferase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MAFEPPQRLVRALGETAPAGDDWLARLPAAAERAVARRELTVERVQVPGGRSSLVVLVRR
ADGTPAVLKLAPPRARPQSERAALAHWGGLGAVHLLESEAEDGALLLERLHPDVSVRSLP
EAKALLEAAGTLRRLWVAPPAGHVFETVAERTGRQAAAMRAGAGTDPEAAPLVEAALAAR
AELLAAPPEQLLLHGTFRQSKVLSGERMPWLAVGPDPVVGESAFDLARLVRDRVEDLIAA
SSGPSTTRRRIKRLAESLEVDQERLRGWTLFRAVESGVRARRVGREKDAELLLEFASWL
Download sequence
Identical sequences H2JZ46
gi|474985080|ref|YP_007695546.1| WP_014675343.1.21199 WP_014675343.1.57224 gi|386842871|ref|YP_006247929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]