SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386836240|ref|YP_006241298.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386836240|ref|YP_006241298.1|
Domain Number 1 Region: 267-539
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.4e-28
Family Extended AAA-ATPase domain 0.033
Further Details:      
 
Domain Number 2 Region: 713-918
Classification Level Classification E-value
Superfamily TPR-like 1.99e-25
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 3 Region: 79-247
Classification Level Classification E-value
Superfamily TPR-like 3.98e-19
Family BTAD-like 0.0025
Further Details:      
 
Domain Number 4 Region: 3-58
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000051
Family PhoB-like 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|386836240|ref|YP_006241298.1|
Domain Number - Region: 534-592
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000169
Family ROK associated domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386836240|ref|YP_006241298.1|
Sequence length 947
Comment regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MGSPKQRGVLALLLAQPGCPVAMHQIVDALWGEDPPASAVNVVQRHISALRRMLEPEMPS
RGTSRWLVSGAGGYRLDADPDSLDLLRFRDLRGRAAASLRDGDQGETTDLLLEALALWHG
PTASGIPEDVRRHPVFTSVDGEHLATVKEAADLALQATGGDHRARALVPLRQTAVQYPLD
EELQARLILMLAATGHQAEALEVYQCVRTQLFNELGVHPGPQLRSAQQRVLGRAFGEAAK
PRETPADAAHGRSRTPKAPPSDTPRDTMPSPAQLPPDLASFTGRAEELDVLRALVPDEPA
STVVISAIGGMAGVGKTTLAVHWAHQIADRYPDGQLYVDLRGFHPAGSIMSPAEAMRSFL
DAFEVPAQRIPAGLEAQAALYRSLLAERRVLIVLDNARDTEHVRPLLPGAPGCLVVVTSR
HQLYGLVAGEGAHSVTLDVLSEAEALRFLSHRLGAERVVRETVAAAEIVASCAGLPLALV
VVSARAVFNPTLSLASIASELRDSGDSLQAFAGEIPAADARSAFSWSYRLLSPAAARAFR
LLALHPGHDCSLTAIASVAGQPPGRVRLLLAELVRAHLVSETAPGRYSCHELLRAYGVEL
GRSEDAPAELGAARRRLLEHYLHSAHAADSVLAPSRERISLRPGTAGVTVARFDDRAGAA
DWLDANRSVLLAVIEESAEYDHAEYGWQLAATIESYLDRNGRWVEQLAAQATALSAAQRS
GDVRGQAHAHRALGFAHGRLERWTEADEHLDRALILFAQLGDEAGQGRVHRYCAFLANAR
GLYRKSLEHYERAGTHYRSAGRHSGEASVANEVGWTYILMGDYHRALLECGRSLASHQDL
GDRNGEAAAWDSLGCAHLHLGDHDRALDCFGHALQIYRAIKDRYLEADTLVHIGDTHSAA
GRSTRAAAAWRTGLEILEEIGHPDAVPVRAKLKSTADSGSAKGCERR
Download sequence
Identical sequences H2K4N9
gi|386836240|ref|YP_006241298.1| WP_014668786.1.21199 WP_014668786.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]