SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386839712|ref|YP_006244770.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386839712|ref|YP_006244770.1|
Domain Number 1 Region: 12-308
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-60
Family Protein kinases, catalytic subunit 0.0000923
Further Details:      
 
Domain Number 2 Region: 526-799
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.85e-25
Family Quinoprotein alcohol dehydrogenase-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386839712|ref|YP_006244770.1|
Sequence length 849
Comment serine/threonine protein kinase [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MQPLRATDPRHIGPYATTHRLGAGGMGEVYLAESRTGLRLAVKVVRAEHAEDRTFRARFR
HEVRAAQTVGGADTYTARVVDADTDAERPWMATEFVSGPNLRDAILDHGALPRPAVRILA
AALGEALAAIHAKGLVHRDLKPSNILLGPDGPRVIDFGIVRALEATALTRTGAVVGSVGY
VSPEQIRNGGQVGPPSDVFSLGAVLAYAAAGREPFGEGQDSVVLLRILTRDFDLSGVPDD
IRPLVTACLREDPLERPEPAEVVASAGFAPDTLRAAVRPGWYGPASRPRPAPDDRPSGVE
YLAPHPTATPADATTRATWTDPATPVALEGSAIPAGHGDSAVSATPRGSVAHADPADSAA
RAARTDVTDRATPADSAAPVTLEGSAIPAGHGGSAVSATPSGSVAHADPADSAARAARTD
PAGSAAPAAPLGPAAPAAPDGSADPGTPGGSAGAVTSVDSDAPGRRLGAVAPGRRRLLKA
LGGGAVAVAGVGVGGWLWEYGLRTESSGGSDSSSVPSADRTNGAAVLRWQYDLGGIGGLD
GACCALSPDGSVVYAGTSGGVLHAISRDGSKRWKVRLGDDVSTPVATRDAVYCVVGLHSE
DARRLTAVSPSGSPLWTRTLGDQRYDVPVLLGQDVLVSVGGTTTGGLRCYASDGGEKWTA
KTLAGPTGTPIVSGGTVFTGSYGDVLLALDARDGSRKWEVSGGTDVTALVLAGTTLFADS
AAELRGFRVTDGRRLWRREDDGGILTGGSRTLAVGTEQGGVYAVRAADGSRAWRYGFEGG
RAYPRAVLSGDTVYARAGEKVCALDLNGKRRWNAVLGRDAGDDQHTPVARGGRLYVPSGT
GIAAVDVRA
Download sequence
Identical sequences H2JWZ4
gi|474981923|ref|YP_007692389.1| WP_014672229.1.21199 WP_014672229.1.57224 gi|386839712|ref|YP_006244770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]