SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386840436|ref|YP_006245494.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386840436|ref|YP_006245494.1|
Domain Number 1 Region: 25-159
Classification Level Classification E-value
Superfamily TPR-like 0.000000127
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 
Weak hits

Sequence:  gi|386840436|ref|YP_006245494.1|
Domain Number - Region: 317-336
Classification Level Classification E-value
Superfamily Sec-C motif 0.00118
Family Sec-C motif 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386840436|ref|YP_006245494.1|
Sequence length 337
Comment hypothetical protein SHJG_4349 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MRPDTPAETVDHTAEAARLERTAGLYPEDAETLLLRAAAHLELSGDRPAATALYDRLLTS
ADGLDNPALVRALKASNLWEYGHEAEARAIIEGIRTTAPRDPAPWVIVAEALESHDELEA
AAETFGEAADLLLPDSPEEPPPATHPLLYGRHRVRRMLGLPHDDRDTLADTLHTSPVSLD
ELHDPKRVWSLGSDNPAELAAEISRLRAELGAYREALSRPFPVAVLHWPAPELSELLSAY
PTLSSEYPSHTDHLATIESSLRELSASGTPNLGIVTGTVPSYEAFAASEGTSPTDPTLLP
QYATTLAARGRAVAWPPGRGAECWCGSAQTYDACHGA
Download sequence
Identical sequences H2JM24
gi|386840436|ref|YP_006245494.1| WP_014672951.1.21199 WP_014672951.1.57224 gi|474982645|ref|YP_007693111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]