SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386841589|ref|YP_006246647.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386841589|ref|YP_006246647.1|
Domain Number 1 Region: 152-311
Classification Level Classification E-value
Superfamily TPR-like 1.37e-30
Family BTAD-like 0.00073
Further Details:      
 
Domain Number 2 Region: 398-610
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.98e-27
Family Gluconate kinase 0.069
Further Details:      
 
Domain Number 3 Region: 1018-1205
Classification Level Classification E-value
Superfamily TPR-like 1.26e-19
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 4 Region: 77-150
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.00000000000034
Family PhoB-like 0.0012
Further Details:      
 
Domain Number 5 Region: 951-1045
Classification Level Classification E-value
Superfamily TPR-like 0.00000000446
Family CT2138-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386841589|ref|YP_006246647.1|
Sequence length 1229
Comment transcriptional regulator [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MRRCELHFGLLGPPVLYDRPPHGISYDSSYATSPETSGTAPGTLGTSPGPSGAASRSSGS
PTARRPAGKAGHDAPDNSVRAIGSPKVRALLAALLLEPGRVVSVEALKDALWGGAPPVSA
QASLHNHVTRLRRLLDDPERLRAVPPGYVLRVDHGELDVHVFDARVAEARAAHARRDWPD
VVRACASALALWRGTPLSGLPADIGGYALVQRLTEARLLLLELRYDAELALGGARLAALV
PELAALVAEHPLREAYHRQLMLALHRTGRQAEALAVHRDLRARLVEELGVEPGPTVREAH
VEVLRGSGEQRGRDVEYGGSPRPAGQGGQPRREDDSATGDGDGDDDRFGTGTPGHTVGGA
ASPAPQAPPASPSAPPTASAPSASSREGDGPAARQTPRPAQLPAPPAHFTGRADVRRELR
RTLTEPSAPAPAVAVVSGMAGVGKSALALHVAHELRERFTDGQLYVNLHGATPGMTPLTA
TQALAALLRDLGAAPRNIPEHPDAAAALLRSLLAPARILLVLDDAANAAQVRPLLPAGPG
CAVIVTSRSPLTALDGARRFPLSPLTGEDSAALLRAVSGRAGLDAGHALVELTGRLPLAL
RVVAARLAARRALTPDVLAGQLAETGGRLRHLEYDDLSVRRSLAVAHDALAAAEREADRD
AALALRHIGALDLPTYGAPLIARLTGTDERRAEAALDRLVDVALLEETAYGRYAPHDLVR
DFARELADAAPRPTASPAADAAGTDAFGGAPAPVGNESSTEPPGAAGNGASGTTDADDSA
GTTDLTVPERTSGPSAVCGGAPSPESASPVPDRAPDPGPASPLPDRTPGPGPGPAVPDRT
PRPEDAPAVPDLAALRWYAAMAERVLTAVVEPGIDQDDRRRPTSAQPAEHAADVAALAPF
ESAEEAFAWGELELENVVTLVARNAGTDDPRTAAPLSALVRLLFPYVQRSGRVAEMEVLG
RAALGAARRLGDPEAEAYALGDLAGLHFLTGRQNDALALTDQALEIWGRLGTASRIRRCL
NNRGLLLEGLGRFAESGEALRQSLAYSRLLNDPYGEAVTRSHLGNLYEHTDPRAAIEQHR
RSLAIGDEIGAVIVQHSAHCNIGYAHLTLGEPAAAARHFEESLRILGGHGDWHGESQTRL
GLVRALRRLGQTERAADECAELLRRADARADRYMGGLALHQHGFLLRERGRRAEAYDAWR
AAREALDGTDEQAILAELRELVSGGSAAW
Download sequence
Identical sequences H2JM41
gi|474983801|ref|YP_007694267.1| gi|386841589|ref|YP_006246647.1| WP_014674087.1.21199 WP_014674087.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]