SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386842172|ref|YP_006247230.1| from Streptomyces hygroscopicus subsp. jinggangensis 5008

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386842172|ref|YP_006247230.1|
Domain Number 1 Region: 25-231
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000000183
Family Prokaryotic proteases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386842172|ref|YP_006247230.1|
Sequence length 277
Comment hypothetical protein SHJG_6090 [Streptomyces hygroscopicus subsp. jinggangensis 5008]
Sequence
MNKPLLAALSSLAIAGLGATPAVAAPHSAKAAAVTVDFAGTVSLSNCSGSVIRFPGSADT
DPALVLTNGHCLETGFPDPGEVITGQSSSRTFGLLNSAGTKVATLRANQVVYSTMTDTDV
TIYRTTTTYAAIKSSYGISPLTVQDTHPVAGTAIKVVSGYWKRIYGCNIDGFVYRLKEGD
WTWKDSVRYTSACDTIGGTSGSPVIDTATGKVVAVNNTGNEDGQQCTVNNPCEVDANGTV
TVRQGINYAEETYNIPACFTTGNKLNLSAAGCTLPKP
Download sequence
Identical sequences A0A101QIX0 H2JXC9
gi|386842172|ref|YP_006247230.1| gi|474984383|ref|YP_007694849.1| WP_014674651.1.21199 WP_014674651.1.28171 WP_014674651.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]