SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329272|ref|NP_440000.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329272|ref|NP_440000.1|
Domain Number 1 Region: 2-140,169-314
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.16e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.048
Further Details:      
 
Domain Number 2 Region: 296-384
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000223
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329272|ref|NP_440000.1|
Sequence length 399
Comment hypothetical protein sll0703 [Synechocystis sp. PCC 6803]
Sequence
MYQLVIIGASLEGLTAAHSCIERYPTARIALVTQGWEQGWSGDRHGDLGEENFWEELRLL
AAQGVDVVVGQGIFSQSSGLLCQTQERTLEGESYLLTSGKADSKDSNVLAIPGPNSDKVM
PQRWVIVGTLPENLVFAQKLTKLGHGVTILSRNGYLLPGEDREMASLLQCYLASLGIEFW
FNCTNLTSHYNQDKSTYSIQFNHGSEESRHHLAVDNLLAIGRSLKYGNLLANLPEFNQTL
KDSSYLSINDHLQTAHSQIYACGDWLKGYHCPAIAQQEARYVVHQVLGKNTTPINYGQIP
FLIDLDPPWYRIGDPACTDYTEKIIRGFEPYSDHCDLRGMYKLALDSQDRIISAHWFGQR
ARESMNLLQLAIAKGISWQELESLPLWENCQILSNFVLS
Download sequence
Identical sequences L8AG49 P72678
gi|16329272|ref|NP_440000.1| WP_010871308.1.11876 WP_010871308.1.1889 WP_010871308.1.18904 WP_010871308.1.33690 WP_010871308.1.35395 WP_010871308.1.47586 WP_010871308.1.99424 gi|383321011|ref|YP_005381864.1| gi|383490065|ref|YP_005407741.1| 1148.sll0703 gi|383324181|ref|YP_005385034.1| gi|16329272|ref|NP_440000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]