SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329276|ref|NP_440004.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329276|ref|NP_440004.1|
Domain Number 1 Region: 1-227,327-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.28e-32
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 230-323
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000000589
Family D-aminoacid oxidase-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329276|ref|NP_440004.1|
Sequence length 372
Comment hypothetical protein slr0734 [Synechocystis sp. PCC 6803]
Sequence
MPNIAVIGAGVVGAAIAYELSLMSGLTIDLFDAQEPAQGATGAALGILMAVISQKTKGRG
WRLREQSLQRYRTLLPELETATGKTIPGDRQGLVKILLEADWSRWQQLQAVRRSQGYPLE
LWTRPEVEQKLSGWPLGYGPIAGAIYSPWDWQIQPQALTQRLIEAAQQRGVRCHFHQAAH
PLPVADSINHCQNIQTNQAKFPTDYVVITAGLGSNLLINPNSDNNESLQLQPVIGQAFLL
QLADADNPLKNSPWRSVLTTEDIHLVPLANGQFWLGATVEFPSDCANGEPNVQLRENLWH
QAIAYYPFLERAEIINYWSGKRPRPVGESAPVIRPLDGYDNVLLATGHYRNGVLLAPGTA
QEVKTWLKAKLA
Download sequence
Identical sequences L8AG55 P72682
gi|16329276|ref|NP_440004.1| gi|383324186|ref|YP_005385039.1| gi|16329276|ref|NP_440004.1| gi|383321016|ref|YP_005381869.1| gi|383490070|ref|YP_005407746.1| 1148.slr0734 WP_010871313.1.11876 WP_010871313.1.1889 WP_010871313.1.18904 WP_010871313.1.33690 WP_010871313.1.35395 WP_010871313.1.47586 WP_010871313.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]