SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329279|ref|NP_440007.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329279|ref|NP_440007.1|
Domain Number 1 Region: 479-653
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-40
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 408-491
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.32e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0006
Further Details:      
 
Domain Number 3 Region: 274-414
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000106
Family Heme-binding PAS domain 0.022
Further Details:      
 
Domain Number 4 Region: 221-269
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000017
Family HAMP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16329279|ref|NP_440007.1|
Sequence length 663
Comment drug sensory protein A [Synechocystis sp. PCC 6803]
Sequence
MGTSVSNPTAILQTMQGFLRKWWSEFNLQTRLMAAATLVVSLLMSGLTFWAVNTIQEDAQ
LVDTRFGRDVGLLLAANVAPMIADKNLTEVARFSSRFYENTSNIRYMIYADPSGKIFFGI
PYSEETVQNSLTLERRIELPQIDPHNFDQPFVRQHHTPNGDVTDVFIPLQYQGKFLGVLA
IGINPNPAAVNSSNLTRDVTIAVFISIWVMVILGAVFNALTITQPIKELLLGVKNIAAGN
FKQRITLPFGGELGELIVNFNEMAERLERYEAQNIEELTAEKAKLDTLVSTIADGAMLVD
TNLQLLLVNPTARRLFAWENKPIIGENLLENLPPEITAQLTQPLRELAADQGSLLFSPGH
GPQEEEQDKTYAPEEFRISLTQPFPRTIRLMLTQVLDQNRENLRGIVMTVQDITREVELN
EAKSQFISNVSHELRTPLFNIKSFIETLSEFGEDLSEVERKEFLETANHETDRLSRLVND
VLDLSKLESSKIYQLDAVDLYQLIEQSLRSYQLNAKDKQLQLEKILDPDLPFALGNYDLL
LQVMTNLIGNSFKFTKAGGKIIVRAYPLHRSNLRAEDGPGLVRVEISDTGIGIDPEDQAA
IFERFYRVENRVHTLEGTGLGLSIVKNIIAKHQSQIHLVSEVGVGTTFWFDLAVYQSMLM
VVG
Download sequence
Identical sequences L8AEH7 P20169
WP_010871316.1.1889 WP_010871316.1.33690 WP_010871316.1.35395 WP_010871316.1.47586 WP_010871316.1.99424 gi|383321019|ref|YP_005381872.1| 1148.sll0698 gi|16329279|ref|NP_440007.1| gi|16329279|ref|NP_440007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]