SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329579|ref|NP_440307.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329579|ref|NP_440307.1|
Domain Number 1 Region: 151-327
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.8e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0084
Further Details:      
 
Domain Number 2 Region: 2-174
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.04e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329579|ref|NP_440307.1|
Sequence length 382
Comment hypothetical protein slr1591 [Synechocystis sp. PCC 6803]
Sequence
MAKKLLLVGGGHSNALVLKHWCRHPLADVELTLVSDVRQTPYSGMLPGYLAGFYSYGESH
IDLAPLCASAGAIFVQDKAIAVNPEQNLLTTAEGRQLSFDCLSLDIGSTPFIDDIVGAEY
GIPAKPVPQFLTAWLALLENIDQNRPKKVTLAIAGGGAGGVELAFNLQARLAKLFPAMGL
DMQIWQRGAILLPHHSVQGRKLIERLLVKQNIAVLLNHPVTSIEPEFSPDDNPLTCYKLW
SNDHWQSVNAVFLVTQASPAPWLAQSGLSLDSRGFVSVKPTLQSYSHGHIFAAGDVANMI
DHPRPKAGVFAVRQGKPLFENLQHYLSHQTLKTFVPQSKYLSLLGTRDGRAIALWGPWAS
YGHCWWRLKDYIDRQFMAGFSA
Download sequence
Identical sequences L8AGF6 P72969
SgR75 gi|16329579|ref|NP_440307.1| gi|16329579|ref|NP_440307.1| gi|383324490|ref|YP_005385343.1| gi|383490374|ref|YP_005408050.1| gi|383321320|ref|YP_005382173.1| WP_010871615.1.11876 WP_010871615.1.1889 WP_010871615.1.18904 WP_010871615.1.33690 WP_010871615.1.35395 WP_010871615.1.47586 WP_010871615.1.99424 1148.slr1591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]