SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330188|ref|NP_440916.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330188|ref|NP_440916.1|
Domain Number 1 Region: 4-104,201-328
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.01e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330188|ref|NP_440916.1|
Sequence length 409
Comment hypothetical protein slr0876 [Synechocystis sp. PCC 6803]
Sequence
MSALNHQIIVVGGGAAGITVAAQLLKQKPKLDLAIVEPCDKHYYQPAWTLVGGGAFAMED
TIKPEQDCIPSGAKWIKASVASFDPENNCLTLQDGRSLSYEYLVVCPGIQINWHLIPRLQ
ESLGKNGVTSNYDRRYAPYTWELLQNFKGGNALFTFPATPIKCAGAPQKIMYLADETFRK
NGVREKTNITYGVAVGKIFGIPGYCESLEKVAAKKNIDVRYHHNLKAINPNAKEATFTVN
GKTEVTLPYDIIHVTPPMSAPDFIKNSPLAAEAGGWVDVDKFTLQHNRYDNVFSLGDASS
LPTSRTAAAVRKQAPVVATNLLGLLNSKKPSAEYGGYTCCPLVTGYGKTIMAEFDYGGQP
KSSFPFDPTQERWSMWLVKRYVLPWLYWNRMLKGESFEPDKWKPLLGKS
Download sequence
Identical sequences L8AIJ4 P73556
WP_010872226.1.11876 WP_010872226.1.1889 WP_010872226.1.18904 WP_010872226.1.33690 WP_010872226.1.35395 WP_010872226.1.47586 WP_010872226.1.99424 gi|16330188|ref|NP_440916.1| gi|16330188|ref|NP_440916.1| 1148.slr0876 gi|383325100|ref|YP_005385953.1| gi|383490984|ref|YP_005408660.1| gi|383321931|ref|YP_005382784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]