SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330526|ref|NP_441254.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330526|ref|NP_441254.1|
Domain Number 1 Region: 59-304,415-487,588-630
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-41
Family FAD-linked reductases, N-terminal domain 0.055
Further Details:      
 
Domain Number 2 Region: 339-411
Classification Level Classification E-value
Superfamily ISP domain 1.26e-18
Family Rieske iron-sulfur protein (ISP) 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330526|ref|NP_441254.1|
Sequence length 650
Comment hypothetical protein sll0254 [Synechocystis sp. PCC 6803]
Sequence
MTELPPNPNSTVVSRRTALKLLGVGTLGGAIGYSRLAKPQPARYDTDRLDLPQYLSQLKS
VVVVGAGLAGLASAYELSKRGFKVTLLEKSPNLGGKVAGWPIQVGEETFQMEHGFHGFFP
QYYNLKSIVNELAIADNFRSLDFYSLVFKEGYEPEVFRPSHSAFPWNIVDLTISSPNRLR
WGINLTKPAHWQVFRAITGFQIPKSYDQLDSITVSDWVAKGFPKGLYDLYFLPFAKSSLN
APDVLSAGELMQFFHFYFFGNPEGLAFNGTKDDMVTSLVMPMVESIKAHGGQIITEATVS
AINCDQGLIQSLQYVQGDDPVSDVPFTVPRNDLLTQANPGGNVYYGAGDRVYWAKPEGKE
ALSLTCSHQGCTVAKQENGQFICPCHGAVYDADGQVIQGPAKRNLAKFAVKPGSSATEVQ
LVSRTKDKPPAQTLKADYYVLAADVVGMKNLADRLGGDVNPQFVQQVKNLAVADPFAVAR
FWFDQDFEWPHSNFASLSGYRLTDSITLYHRIQNQFIAWAERTGGSVVELHAYCYKEKEF
PTQGDLLATFEQELYEIVPSLATAKLLHRELVNQKNFSGFPPNSYGDRPETETPVANLLF
AGDWVKMPFPCGLMERAISSGLLSANAICHQEGLQRRELLTVMPEGILQI
Download sequence
Identical sequences L8AI35 P73872
gi|383491320|ref|YP_005408996.1| NYSGRC-FDAO-BAA17934 gi|16330526|ref|NP_441254.1| WP_010872561.1.11876 WP_010872561.1.1889 WP_010872561.1.18904 WP_010872561.1.33690 WP_010872561.1.35395 WP_010872561.1.47586 WP_010872561.1.99424 gi|16330526|ref|NP_441254.1| 1148.sll0254 gi|383325436|ref|YP_005386289.1| gi|383322267|ref|YP_005383120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]