SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330815|ref|NP_441543.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330815|ref|NP_441543.1|
Domain Number 1 Region: 494-664
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-44
Family Histidine kinase 0.00055
Further Details:      
 
Domain Number 2 Region: 422-507
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.69e-23
Family Homodimeric domain of signal transducing histidine kinase 0.00089
Further Details:      
 
Domain Number 3 Region: 333-380
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000183
Family HAMP domain 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|16330815|ref|NP_441543.1|
Domain Number - Region: 99-173
Classification Level Classification E-value
Superfamily PTPA-like 0.0451
Family PTPA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330815|ref|NP_441543.1|
Sequence length 674
Comment sensory transduction histidine kinase [Synechocystis sp. PCC 6803]
Sequence
MVSIIKSVRRSLLLKFVLSYFCLSSVVVASIFLVANYRAVKGIESQTFNRLNISNNLKEY
QLEQWMEGQKDTLFLLSDINSIQANTELLKNTSVSDPQYKIIQKRLIEELREIDLFLPHI
EAINILNTGGIVVASNNLDEIGVYKGIGNQTTYFANINSNFKTVPNFYFSKVYNRPSMTF
ATNIKHDITRERLGYLSIDINLNAVDDLIRKRTGLGDTGETFLVGEINNQVSFIASDENK
KLTANGSKPNFNSLGINSVMAGNSGQGSYVNYAGTPVLGVYQWIEKYNLALITEISEVEA
LELARRFTRMLVLVGLVSTALLLIAVYLLSIKITKPILLITKAAIDISSGDREARAPVLG
EDELGILAKSFNLMTNELRESNSSLEKKNQELELAQKQLAVANSCLEEKVQQRTEELENT
VKALELASSEAEAANATKSIFLANMSHELRTPLNAIIGYSEMLIEEAEDLDSEELVPDLD
KILRSGKSLLALINDLLDISKIEAGKMELYLETFNLKELIAGILDTISPLLKNNNNKLEV
EISLESEEVYGDLIKLRQGILNLLSNASKFTKDGIISFIVEEFKVDEKDWLSFQVKDTGI
GLTEEQMSKLFQPFTQADSSTTRKYGGTGLGLAITRKFCQMMGGDIYLTSEIGVGSSFTI
KLPKYAQLNSAKND
Download sequence
Identical sequences L8AU59 P74137
WP_010872846.1.11876 WP_010872846.1.1889 WP_010872846.1.18904 WP_010872846.1.33690 WP_010872846.1.35395 WP_010872846.1.47586 WP_010872846.1.99424 gi|383491610|ref|YP_005409286.1| gi|16330815|ref|NP_441543.1| gi|16330815|ref|NP_441543.1| gi|383325726|ref|YP_005386579.1| gi|383322557|ref|YP_005383410.1| NYSGRC-FDAO-BAA18223 1148.sll1871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]