SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331256|ref|NP_441984.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331256|ref|NP_441984.1|
Domain Number 1 Region: 103-289,482-531
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.27e-34
Family HI0933 N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331256|ref|NP_441984.1|
Sequence length 540
Comment hypothetical protein sll0175 [Synechocystis sp. PCC 6803]
Sequence
MLRISEIKLPLDHDDIALEEAILKKLGVSSKELTSYTIFKRSYDARKRGQILLVYIVDVV
TPLEQKLLNKLAGDRQIIPSPDTTYKLVAQVKPDQKFEGKRPIVIGTGPCGMFAGLLLAQ
MGLKPIILERGKSVRDRSVDTFRFWVKGKLHAESNVQFGEGGAGTFSDGKLYSQVRDPNH
YGRKVLEEFVKAGADPEILYINRPHIGTYRLVKIVQNLRSTIEELGGEIHFQSHVTDINI
KDNQVQGVTLENGDYIATNHVVLAVGHSARDTFKMLFERGVYIEAKPFSIGFRIEHPQSL
IDQCRFGTQAGHPRLGSADYKLVHHCQNGRSVYSFCMCPGGKVVAAASEPGRLVTNGMSE
YARDEANANSAIVVGITPEVDYPDHPLAGIALQRFWEERAFQLGGENYQAPGQLVGDFLA
NRPSTKFGFVLPSYKPGVKLVNLGESLPDYAIAALREAIPAFDKKIRGFAMDDAVLTGVE
TRTSSPIRIKRGDDFQSINTVGLYPAGEGAGYAGGILSAGIDGIKVAEAIALDFFAKVDV
Download sequence
Identical sequences L8ARQ2 Q55555
SdR26 gi|383492052|ref|YP_005409728.1| gi|383322999|ref|YP_005383852.1| 1148.sll0175 gi|16331256|ref|NP_441984.1| gi|16331256|ref|NP_441984.1| WP_010873283.1.11876 WP_010873283.1.1889 WP_010873283.1.18904 WP_010873283.1.33690 WP_010873283.1.35395 WP_010873283.1.47586 WP_010873283.1.99424 gi|383326168|ref|YP_005387021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]