SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331344|ref|NP_442072.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331344|ref|NP_442072.1|
Domain Number 1 Region: 20-329,431-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.88e-64
Family FAD-linked reductases, N-terminal domain 0.0000875
Further Details:      
 
Domain Number 2 Region: 310-417
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.63e-28
Family L-aminoacid/polyamine oxidase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331344|ref|NP_442072.1|
Sequence length 471
Comment amine oxidase [Synechocystis sp. PCC 6803]
Sequence
MVIRSGKTNLNPPCALMAPSSSCDCIIVGSGLSGLIAARNLSRVNYSVLVIEAQERLGGR
MYGEYLPSGQWIDRGGQWVGPTQDRFLALLNEYNIERFPSPADGLKVLLFDGKRYEFDGF
FQGVFQGEAPKISSDEWNDAMVAWEKFNTLAQSLDEQHPEATPENKKLDSQTFADWIKEN
THTAFGHWYFSYMCRAVGFLGPAEPSQVSLLHILWGHKSASQGENPEAELLHGGAGQIPQ
KIAAELGNSILLGEPVIHIAQDDKGVEVTTTTGKYQGKFAIVATPPHLAGRITYSPPMPP
LRQQLTQRVPMGTCCKLLISYDRPFWREKGLAGIGLGNTTWIELCADSSDPTTGVGVIAS
FVVGDRYGKWIAMGEAERRQGVLSDLALYFGEEALSPETYDEVDWPSEQWVGGGYAAFMP
PGVWTSFGQALSAPVGRIHWAGTEIAPRWAGFFDGAIRTGEAAAKAIIGLL
Download sequence
Identical sequences Q55629
gi|383326254|ref|YP_005387107.1| gi|16331344|ref|NP_442072.1| 1148.slr0782 NYSGRC-FDAO-BAA10142 WP_010873371.1.11876 WP_010873371.1.1889 WP_010873371.1.18904 WP_010873371.1.33690 WP_010873371.1.35395 WP_010873371.1.47586 WP_010873371.1.99424 gi|383323085|ref|YP_005383938.1| gi|383492138|ref|YP_005409814.1| gi|16331344|ref|NP_442072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]