SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331357|ref|NP_442085.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331357|ref|NP_442085.1|
Domain Number 1 Region: 11-144,214-326
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-17
Family FAD-linked reductases, N-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331357|ref|NP_442085.1|
Sequence length 498
Comment hypothetical protein sll0321 [Synechocystis sp. PCC 6803]
Sequence
MVQVGAAAINRVDVAVIGGGIAGVAIAEYVARHTNLSVQLLEQNSHLGGDSSGKLEGWFH
TGALYSGQDDGQTFFNCVNGVEDLLNHYSHYFAGRCNLTLEQFDHGYRPTVTGAGWFDPN
PVYLIHPQRHSPEMLQSGLKGDRVQLEMQLKRVLGRLEMAYGQQFNWRSPTGNGAVAPDY
DHLESYEQRSCSLLGQSEKISHYCQQFDLSHGVKPSDYALLKSLDCAMDTQGILQDLTAS
ALAHGTAIATGINLEQINVDRYGPVRVQSIFYRDCQGQQHYLKAKAFIFAVGAGFERILP
TLQVRAKLKQSRSTMVVAYPAISSHNFVRMSTKNSYHFNHFFQRANIPDSSEFLNYSMLA
NSGYVSNENDYLASGEIELLLDTAARYFSEENLYQRQLWSYDCVKTEFISDDAQKRRYSY
WIEVNPQSNYLCVLPGKFSFFPTVAVQTLKQLKTILPTEEVDRSHRDYSAHYHQAQALVA
SPYPHQLLASYWKNNANS
Download sequence
Identical sequences L8ARG8 Q55639
gi|16331357|ref|NP_442085.1| WP_010873384.1.11876 WP_010873384.1.1889 WP_010873384.1.18904 WP_010873384.1.33690 WP_010873384.1.35395 WP_010873384.1.47586 WP_010873384.1.99424 gi|16331357|ref|NP_442085.1| 1148.sll0321 SgR64 gi|383492151|ref|YP_005409827.1| gi|383323098|ref|YP_005383951.1| gi|383326267|ref|YP_005387120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]