SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331423|ref|NP_442151.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331423|ref|NP_442151.1|
Domain Number 1 Region: 6-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-18
Family FAD/NAD-linked reductases, N-terminal and central domains 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331423|ref|NP_442151.1|
Sequence length 456
Comment tRNA (uracil-5-)-methyltransferase Gid [Synechocystis sp. PCC 6803]
Sequence
MTTLTPIHVIGGGLAGTEAAWQIAQAGVPVILTEMRPERLSPAHHSEDLAELVCSNSFGA
KAGDRAAGLLQTELRQLSSLIITTADRHAVPAGGALAVDRGIFSRSLTEQVASHPLVELR
RGEVTEIPREGITVLTTGPLTSPALTEDLQQFTGMEYLSFFDAASPIVVGDSINKEVAFF
ASRYDKGEAAYLNCPFNREQYFNFWQALCEAEQAPLKDFDRETAKFFEGCLPIEELAQRG
EDTMRYGPLKPVGLFDARLGDFRDPANKEKKPYAVVQLRQEDKAGQLWNMVGFQTNLRWG
EQGRVFRLIPGLENAEFVRMGVMHRNTFINSPQLLTASLHFGDRQTLFAAGQLVGTEGYA
AATAGGWLAGTNAARLALGLPLLTLPATTMMGALFNFISSASPKHFQPMPPNFGILPELP
QRIRNKQERYGQYRDRALADLTTWQTSIKSLATCRV
Download sequence
Identical sequences L8AP33 Q55692
gi|16331423|ref|NP_442151.1| SgR139 WP_010873449.1.11876 WP_010873449.1.1889 WP_010873449.1.18904 WP_010873449.1.33690 WP_010873449.1.35395 WP_010873449.1.47586 WP_010873449.1.99424 1148.sll0204 gi|16331423|ref|NP_442151.1| gi|383326334|ref|YP_005387187.1| gi|383492218|ref|YP_005409894.1| gi|383323165|ref|YP_005384018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]