SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331824|ref|NP_442552.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331824|ref|NP_442552.1|
Domain Number 1 Region: 4-188,348-406
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.9e-43
Family HI0933 N-terminal domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 185-351
Classification Level Classification E-value
Superfamily HI0933 insert domain-like 1.96e-42
Family HI0933 insert domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331824|ref|NP_442552.1|
Sequence length 408
Comment hypothetical protein sll0586 [Synechocystis sp. PCC 6803]
Sequence
MTRTVIVVGGGAAGFFGAINCARNLPEGRVILLEAGSKFLAKVRISGGGRCNVTHHCFDP
TQLVQNYPRGGKALRGAFSRFQPQQTIAWFGAEGVQLKTEADGRMFPVTDDSGTIVDCLL
SAARRSGVELRNRSPVQGLEKLGEQFQVTLKSGEIINGDRLLLATGSNPLGYRWAAQLGH
TIQAPVPSLFTFNIPNAQLTDLAGVSVENALVSLDPKFKGIYCHQGPVLITHWGLSGPAV
LKLSAWGARQLQASGYDHSLWINWLPKVTPLESMAQWRATKQSHPRKQIANFTATALPKR
LWQRLTTQAGIKPGQCWADFSKVQERQLTENIHRYHCQIKGKGVFKEEFVTCGGITLKEV
DFKTMASRCCPGLYFAGEILDVDGITGGFNFQNAWTTAWLAAQGMAAP
Download sequence
Identical sequences L8AQR2 Q55864
gi|16331824|ref|NP_442552.1| gi|383323567|ref|YP_005384421.1| 1148.sll0586 gi|383326736|ref|YP_005387590.1| gi|16331824|ref|NP_442552.1| gi|383492620|ref|YP_005410297.1| WP_010873850.1.11876 WP_010873850.1.1889 WP_010873850.1.18904 WP_010873850.1.33690 WP_010873850.1.35395 WP_010873850.1.47586 WP_010873850.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]