SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332065|ref|NP_442793.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332065|ref|NP_442793.1|
Domain Number 1 Region: 3-385
Classification Level Classification E-value
Superfamily Ammonium transporter 2.48e-98
Family Ammonium transporter 0.00002
Further Details:      
 
Weak hits

Sequence:  gi|16332065|ref|NP_442793.1|
Domain Number - Region: 482-510
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0196
Family HAMP domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332065|ref|NP_442793.1|
Sequence length 541
Comment ammonium/methylammonium permease [Synechocystis sp. PCC 6803]
Sequence
MTSIDTLWLLLCAGLVFFMQAGFMCLESGLTRSKNSINVAIKNFADFGISVALFWSFGFS
IMFGLSQGGWWGTGYSFVDVGGEPTLAVFFLFQAMFCGTATTIISGAAAERLKFSAYLLV
AGLASGLIYPLFGDWAWNGLATVAGIETTGGWLENLGFRDFAGSTVVHSVGAWIGLATIL
VVGPRQGRFPKTGKTLKIQGSNMPFSVLGTLILWFGWLGFNGGSTFGLTPEVPGIMVNTV
LAGVGGMLMAGLISLLQDKMIQVEPLMNGSLAGLVAITASANVVMTPIAMVIGATGSAIA
YLVGKKMLHWGVDDAVDAVAVHGGAGVWGTLCVGLFGQLPLVDTGLNRWQQCGVQLLGIG
VCTLWAFGLAWVFLTLLNRVFALRISPEDEEIGLNVSEHQATTETYELFQVMDRQAKTHD
LSLRVPVNPFTEVGHIAGRYNQVMDAFEARHHRSVEDLAQIYYVTAAIAAAIENNSFKAD
QLGLEEVTNRADELGALARTIQQMAEMLQQRDQELIAVKQQLVLQQQKQHHGNGESVDLS
P
Download sequence
Identical sequences P54148
1148.sll0537 gi|16332065|ref|NP_442793.1| gi|383326977|ref|YP_005387831.1| gi|383323808|ref|YP_005384662.1| gi|383492861|ref|YP_005410538.1| WP_010874087.1.11876 WP_010874087.1.1889 WP_010874087.1.18904 WP_010874087.1.33690 WP_010874087.1.35395 WP_010874087.1.47586 WP_010874087.1.99424 gi|16332065|ref|NP_442793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]