SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332182|ref|NP_442910.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332182|ref|NP_442910.1|
Domain Number 1 Region: 48-245
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.29e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 
Domain Number 2 Region: 193-388
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.76e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332182|ref|NP_442910.1|
Sequence length 524
Comment NADH dehydrogenase [Synechocystis sp. PCC 6803]
Sequence
MGFQFPGNWPHFLLACYLYRGSASGHSETCSGVGWKTVAINSSDSATTVIIGGGFVGLFT
ALHLRHHQHAGPIVLVEPQANFVFKPMLYELLTEELPESVVCPSYEKLLADSGIDIVQAR
VADVQLKEKRLVLDSGQEQHYDYLVLAVGSVQGYLGAQGAAENAFAFRSQTEAIALRDHL
KACLEKSLTTADQAEKERLLTVAIVGAGPAGVEMAATLADLLPSWYVPMGGNINDLKIYL
VNHAPGILAGDANSGLKRCALEELQARTIPVTLKLGVGVKSVTPESLQFVETGEEELRHL
DTGTTIWTAGTAVNPLLKTLKEQIPAEELDRHGQPLVTSTLQLPSFPQVFAAGDCVTVKD
NPKPALAQIAYQQGAAIAKNLMAVHNGKPLVSPDPQLRGTLMKLGLNNGVANLFDRVRIQ
GKAGDLLRNATYLELLPTPLHNFKSTTQWLAEETIDRFHRPHAPTAQELKWAAMTPAQRQ
EHQGIKAIAIIAPLIFIVLLYLGFKTPERERAPFVPQPSPGMNR
Download sequence
Identical sequences P74614
WP_010874204.1.11876 WP_010874204.1.1889 WP_010874204.1.18904 WP_010874204.1.33690 WP_010874204.1.35395 WP_010874204.1.47586 WP_010874204.1.99424 1148.sll1484 gi|16332182|ref|NP_442910.1| SgR78 gi|16332182|ref|NP_442910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]