SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38505571|ref|NP_942192.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505571|ref|NP_942192.1|
Domain Number 1 Region: 3-107,243-321
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.98e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.066
Further Details:      
 
Domain Number 2 Region: 119-247
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000684
Family FAD-linked reductases, N-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505571|ref|NP_942192.1|
Sequence length 428
Comment sulfide-quinone reductase [Synechocystis sp. PCC 6803]
Sequence
MAQIVVIGAGLGGLPAAYELRHYLGKAHQVILISEFPQFTFVPGLVQVGLGHIPLDHMQL
NVPMLAKRHGFKWVQGKVQKIDPLQKRIYTHETLNYDYLIIASGAELANDLVPGLGIYTH
SICTPSHVLEARTAWETFCQQPGDLVVGAAPGTGCFGPAYEYVLLAEADLRRRGIRDQVK
ITYITPEPYIGHLGIANMAHSQTLTEALMNKRGIATLTNAQIVNISSDHIFLADGQSFGF
AYSMILPAFRGAKFVKASGLGNERGFLPVLPTMRHRDYPEIYGVGVSVHLGQINDTQVSI
GTPKSGQMTEAMAMVAAHNIAVELGSIAKPLQVPTLEALCFAEYGDTGIAYIAAPVLPDR
LTGKRRYSYAIKGIWVNWAKAAFEKYFLAKMRLGVGLPWFEKLGLRLLFGLSMSRPAMAE
DIVQPVNV
Download sequence
Identical sequences Q6ZEU4
gi|38505571|ref|NP_942192.1|NC_005229 gi|451816579|ref|YP_007459782.1|NC_020296 gi|38505571|ref|NP_942192.1| gi|38505571|ref|NP_942192.1| WP_011153573.1.1889 WP_011153573.1.35395 1148.sll5036 SgR73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]