SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16329869|ref|NP_440597.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16329869|ref|NP_440597.1|
Domain Number 1 Region: 11-176,397-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.68e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16329869|ref|NP_440597.1|
Sequence length 599
Comment hypothetical protein sll1913 [Synechocystis sp. PCC 6803]
Sequence
MAIATKSIARLTTDILVVGGGTGGTAAAIQAARRGVKTILVSEGPWLGGMLTSAGVSAPD
GNELAAWQTGLWGEFLRTLTVQQPGGLDHSWVSLFTFDPRLGSKIFADWAAELPNLTWIA
NQCPMEVVKNGDRLVGVRFPDYEIRARVILDGTELGDLLALGDIGHRWGWDWQDKFDEPS
CPIAPNEMTEEYPIQSPTWVFLLRKTTNNQTNIIAEPTIDVAQDFTHTWQNYGEKDFLTY
GQLPGEHYMINWPIAGNDYGKDLNRLLGGEKEKQTYLKEAYQYSYAYAYYLQKHHSENLE
LATGIFPQTGDISTAFALHPYYRESRRLKGQQVITERDILPQGQVASLPIYNQKVTSIGV
GNYANDHHYPGYEFPLTPKSLIWGGRWTGTPFTIPFPALLSPTARGYLPCEKNISVSHMA
NGSTRLQPLVMNTGQAVGMIAALSVEKNCDPQDLDVRDVQEALIGDRRAPAAVIPLFNLV
PDHPEWRQWQQYYLDNPDQYPPSGHCPVDVNLAQLPLSKSQSVYTGELQKSEHQTYQLIC
QQSGKILKVITERPEVAEQLINHANGKKITLGGRYNSAGNWLVVETVETITSGKDLGGR
Download sequence
Identical sequences L8AE99 P73250
gi|16329869|ref|NP_440597.1| gi|383490664|ref|YP_005408340.1| gi|383321611|ref|YP_005382464.1| gi|383324780|ref|YP_005385633.1| 1148.sll1913 WP_010871906.1.11876 WP_010871906.1.1889 WP_010871906.1.18904 WP_010871906.1.33690 WP_010871906.1.35395 WP_010871906.1.47586 WP_010871906.1.99424 gi|16329869|ref|NP_440597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]