SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330139|ref|NP_440867.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330139|ref|NP_440867.1|
Domain Number 1 Region: 130-250,495-559
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 6.47e-36
Family Intein (protein splicing domain) 0.024
Further Details:      
 
Domain Number 2 Region: 555-658
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-29
Family Extended AAA-ATPase domain 0.00049
Further Details:      
 
Domain Number 3 Region: 3-130
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.67e-24
Family Extended AAA-ATPase domain 0.0000471
Further Details:      
 
Domain Number 4 Region: 675-790
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 4.25e-19
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330139|ref|NP_440867.1|
Sequence length 1116
Comment DNA polymerase III subunit [Synechocystis sp. PCC 6803]
Sequence
MAYEPLHHKYRPQTFADLVGQTAIAATLSNAIEQERIVPAYLFTGPRGTGKTSSARILAK
SLNCIAGDRPTATPCGQCATCRAITNGSALDVIEIDAASNTGVDNIREIIERAQFAPVQC
RYKVYVIDECLTGDSQVLTRNGLMSIDNPQIKGREVLSYNETLQQWEYKKVLRWLDRGEK
QTLSIKTKNSTVRCTANHLIRTEQGWTRAENITPGMKILSPASVDVDNLSQSTALTASLG
GLSGAINYEAINTDKKNTTLSLSLKKQKPQDPFVNADVAKNLIFQHFCSAKEEKLKVSNP
IGEDIPTKKATDFGISEQKKLHQGQNRWEQKFSVLSTEPCLGMEVLTIPTHIADSPACDG
PTAPSSQNGWNIKRQDWDVCHPKYDSQPIKAMGKVPSAVKPVVPQTLLMFSAQSNLEVKE
NKFLRNGSRISLKKEWLGGTWTTVPSLFPNLGVHQFSYTQRAFSRKKINLLLNGLPIEDI
PPVQNPIAEALTAKPITTQKWEQWPPASGYRTWKSIPSPQWHTNFEEVESVTKGQVEKVY
DLEVEDNHNFVANGLLVHNCHMLSTAAFNALLKTLEEPPERVVFVLATTDPQRVLPTIIS
RCQRFDYRRIPLQAMVDHLRYIAGRENINIDQPALTLVAQIANGGLRDAESLLDQLSLLP
DLITPDKVWDLVGAVPEQDLLALLEAIASDDAETLLATCRQILNRGREPLVVLQNLASFY
LNLLIAQTAPQRSDLVAVTAETWQALCDTAPQWQRGVILQGQQKLKESEIQIRNTTQPRL
WLEVTLLGLLPSACGLDTGAVSQTAVRTPVAQPITPPKPSNVVTFPGGSHNHLTVVDSPT
MIPVSEPIVLEEKLEADVEPSSFEPSNAHWDLTQLWSETLNNLGALSQSLFKSFGSLINL
VGNNATVSVTTQQLLKIAAGKKDELEAALGQACGQSVKVNLVVGKPSTPETTPVNSAPPP
SHSKPPAFAPEPSPPPTAAVNANPAPTVPPSPPAIARGPATSEIKPSPRRESNNFSNPSR
PKPKPAPAMEEPPPTDIGDSATRKAIEQFAKNFDGEIVASDAAPKQESDNGDDLSTEPTA
ELGQQPMDHNGHLQINQPTVLNRPAIAPEEEEDLPF
Download sequence
Identical sequences P73507
gi|383325051|ref|YP_005385904.1| gi|383490935|ref|YP_005408611.1| gi|383321882|ref|YP_005382735.1| gi|16330139|ref|NP_440867.1| gi|16330139|ref|NP_440867.1| 1148.sll1360 WP_010872177.1.11876 WP_010872177.1.1889 WP_010872177.1.18904 WP_010872177.1.33690 WP_010872177.1.35395 WP_010872177.1.47586 WP_010872177.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]