SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|387872149|ref|YP_005803529.1| from Erwinia pyrifoliae DSM 12163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387872149|ref|YP_005803529.1|
Domain Number 1 Region: 5-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-31
Family Thioltransferase 0.0042
Further Details:      
 
Domain Number 2 Region: 115-248
Classification Level Classification E-value
Superfamily TPR-like 0.0000000466
Family Tetratricopeptide repeat (TPR) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387872149|ref|YP_005803529.1|
Sequence length 286
Comment hypothetical protein EPYR_02778 [Erwinia pyrifoliae DSM 12163]
Sequence
MMSSQAQIVEINETNLHQTLEQSMQVPVLFYFWSERSQHCQQLTPLLDRLAQEYAGQFVL
ARLDCDAEPAVAQQFGLRSIPTVYLFQNGQPVDGFQGPQPEEAVRALLEKVLPKEEELKA
QQAMQLMDENKLIEALPLLKDAWALSKQRSDIGFLLAEVLIGLNRSEEAEAVLNVVPLQD
QDTRYQGLVAQIDLLKQAADTPEIQQLQQQIGAEPDNAELATQLALQFHQVGRNEEALEL
LFSHLKQDLTAADGQARKMLQEILAALGTGDALAAKYRRQLYSLLY
Download sequence
Identical sequences D2T401
gi|387872149|ref|YP_005803529.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]