SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479153349|ref|YP_007783124.1| from Ruminococcus sp.

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479153349|ref|YP_007783124.1|
Domain Number 1 Region: 6-108
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.27e-39
Family N-utilization substance G protein NusG, N-terminal domain 0.0000526
Further Details:      
 
Domain Number 2 Region: 116-171
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000000731
Family N-utilization substance G protein NusG, C-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479153349|ref|YP_007783124.1|
Sequence length 173
Comment transcription antitermination protein nusG [Ruminococcus sp. SR1/5]
Sequence
MSEAAKWYVVHTYSGYENKVKANIEKTIENRHLEDQILEVRVPLQDVVEMKNGTSRQVQK
KMFPGYVLLNMVMNDDTWYVVRNTRGVTGFVGPGSKPVPLTEEEMMPLGIQKPDIEVDFA
EGDMVVVTGGAWKDTAGVITGINMQKQTVTINVELFGRETPVEISFTEIKKAE
Download sequence
Identical sequences A0A1C5LXG0 A0A1G5IXK4 D4LI00 R5N914 R7GSC2 U2DKU1
WP_015525332.1.100942 WP_015525332.1.70591 WP_015525332.1.94155 gi|479153349|ref|YP_007783124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]