SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494683432|ref|YP_007949006.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|494683432|ref|YP_007949006.1|
Domain Number - Region: 62-95
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0391
Family Di-heme elbow motif 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|494683432|ref|YP_007949006.1|
Sequence length 133
Comment hypothetical protein L083_1016 [Actinoplanes sp. N902-109]
Sequence
MQEEPIDPFNGDPADPAAGLDDLSEDAEQDPLTEAERQDVLEDLSDLEIYQALLSPTGIR
GLVIECEDCHEPHYFDWDLLRGNLRHLLSSGRPRVHEPAYDPDPDHYVTWEYARGYADGV
HDTLTEGTDDEKG
Download sequence
Identical sequences R4LB66
WP_015619084.1.60444 gi|494683432|ref|YP_007949006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]