SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494684056|ref|YP_007949630.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|494684056|ref|YP_007949630.1|
Domain Number - Region: 11-83
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000115
Family Cytochrome c3-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|494684056|ref|YP_007949630.1|
Sequence length 144
Comment hypothetical protein L083_1640 [Actinoplanes sp. N902-109]
Sequence
MTVPPPAGETVKVTVRGLTMSCWKCHQPTTVVVGLHLASAVDGDLITCDDEQALATAVEL
LSATGNVGLTRPIKVRTSRTARTTSLTNGCQHCDALQGNFFIYHEELMEVRSANGTDGLD
HLADADLPTEQWQQLHRRWSTGEP
Download sequence
Identical sequences R4LIR1
gi|494684056|ref|YP_007949630.1| WP_015619708.1.60444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]