SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494685049|ref|YP_007950623.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|494685049|ref|YP_007950623.1|
Domain Number - Region: 309-435
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0365
Family Lambda integrase-like, catalytic core 0.029
Further Details:      
 
Domain Number - Region: 7-85
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0753
Family Di-heme elbow motif 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|494685049|ref|YP_007950623.1|
Sequence length 469
Comment hypothetical protein L083_2633 [Actinoplanes sp. N902-109]
Sequence
MLPLGPVCNACYRHSLTTLGTCVSCERRRLIVGRTVDGGDLCATCSTTGEPAQICSKCHQ
PGDLLPGGTCPRCTLENRVAELLHTGDTAGPRPLGPLEAVFAGADNPYQMLTWLRRSRAA
RLLGRLAAHPGDLTHEALDALPQGESTAYVRGLLVSAGILAARDENFALLTRWLARTLTK
LPPAHVTLIRAFAGWHVLRDARRRSARGRYTYAAYRGDSVNIRAAARVLAWLDEQHLTLI
TLQQKHLDTWASGNPTLRAGSIPFIRWAVARGLTTALVIAHPPTRPPSHFQVDDIQQEEL
RQCLTDRSLPRDVRIAGALTRLYALALTRIVELTAGDLCRDADNAYLTISRRPVILPPSL
AYLIEEQIDATTPQRVSADASGYLLPGRSPGRARNPAGLADTMRQHGLPVRAARNTAMMQ
SLADLPPIVIADLFGIAPGTAHRWAQFANNSWSDYLDDLPDTAPATRPS
Download sequence
Identical sequences R4LCD2
WP_015620701.1.60444 gi|494685049|ref|YP_007950623.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]