SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494685058|ref|YP_007950632.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494685058|ref|YP_007950632.1|
Domain Number 1 Region: 242-274,314-350
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000172
Family Di-heme elbow motif 0.036
Further Details:      
 
Weak hits

Sequence:  gi|494685058|ref|YP_007950632.1|
Domain Number - Region: 629-753
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.0124
Family Eukaryotic DNA topoisomerase I, catalytic core 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|494685058|ref|YP_007950632.1|
Sequence length 800
Comment hypothetical protein L083_2642 [Actinoplanes sp. N902-109]
Sequence
MNTEATGSAGAAPRDLIVQQVLAVDPTADRATVENAVAAVVNTVARQRQVLRALADRPEL
LCNGRPPAPQVLGELMLLLRRTSTAAVAAPACRGCARPLSSVRGSAWCCDRCGAPERECA
GCGQLRRSTRRDQAGSWRCPRCRPLPEQPDWAALTAAVRTIDSSAEPAVVRTAARRVAPG
LFRQQALVAAVTADPDLLRGRAAHAPVRTVLRLVDSLTEAGVAGMVRPGCPHCGRVVALV
KWHAEAWLCARCDRQVRAAPCAQCGKVREVSSRDRRGQPLCGPCHSRNPANAERCVGCGH
LRPVNNRTPQGPLCASCRQSPLLTCTLCGERAPGNRSALTGQPRCRSCHARRLRCGGCGK
IRAPHSGTLKDPRCALCTPAQPGTPRRRRHKCPSCGSAQPTESACPSCRLIAIVQPLLTV
GDQVRPELVPLLVWWRRVDRPGSVRTWLARRPAAKALLRDLAAGAVELSHEGLDQIPDTK
TVRYVRRILVAAGVLPTHDEHLRRLEQWMNRAVAAIADPKQRTILYRYAVWYHLRKLRAR
TGLEKPATDGQAAPIRNHVRAAAAVLATLAESGHTLADLRQADIDEWLAGHRVARRAELG
LFLRWARRERLTTVAIPVQQWAGPGSRIDHDHRWALARRLLHDDAVPTEDRLAGLLVVLY
AQTAARIRLLRFDHLDSGSGGVRITFGTTPIDLPPAVADLFARLVAERAGTDRAATPWIF
PGRPWNQPISAGMLRKRLAALSMSTHAARTAALFQLAVDLPAGLLARCLGIDISSAVDWQ
RAAAGDWHAYAARTAGIASP
Download sequence
Identical sequences R4L9L8
gi|494685058|ref|YP_007950632.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]