SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494685166|ref|YP_007950740.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|494685166|ref|YP_007950740.1|
Domain Number 1 Region: 80-213
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 3.92e-22
Family GntR ligand-binding domain-like 0.0088
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-18
Family GntR-like transcriptional regulators 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|494685166|ref|YP_007950740.1|
Sequence length 227
Comment hypothetical protein L083_2750 [Actinoplanes sp. N902-109]
Sequence
MTDPASFLHRSLPEAVYLELRRKILNNEYEAGQRLIEAPLAEELGVSRSTVREALRQLNV
DGLVEITPRRHSVVTRMSYEEIRDACYARFVLEAGAARLLTFHKDPILDRLQAVVDRMAA
TALNGDVAAMIDLDTEFHSCIVDAAGKHRLAALWRTLDAQMGALMRSSIDRQHIGLDEAA
RRHQQVVDVFRVGTAEDFVQILEEHYLGAVDSMAQAGVLDSAGARKP
Download sequence
Identical sequences R4LLX2
WP_015620818.1.60444 gi|494685166|ref|YP_007950740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]