SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|494688426|ref|YP_007954000.1| from Actinoplanes sp. N902-109

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|494688426|ref|YP_007954000.1|
Domain Number - Region: 21-59
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0377
Family Cytochrome c3-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|494688426|ref|YP_007954000.1|
Sequence length 71
Comment hypothetical protein L083_6010 [Actinoplanes sp. N902-109]
Sequence
MTAAKKSQPRWTAASLGVRPFQIPRCASCQAGLCDSAGNPRWDVLSGMRLVCLGCRRRPG
AMPRKAVTARG
Download sequence
Identical sequences R4LWA1
WP_015624078.1.60444 gi|494688426|ref|YP_007954000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]