SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|476417696|ref|YP_007554394.1| from Bifidobacterium breve UCC2003

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|476417696|ref|YP_007554394.1|
Domain Number 1 Region: 187-253
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000366
Family Transglutaminase, two C-terminal domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|476417696|ref|YP_007554394.1|
Sequence length 431
Comment Conserved hypothetical membrane spanning protein, possibly ABC-type permease [Bifidobacterium breve UCC2003]
Sequence
MKHLTTRMLAIIVALLASLSMMLAIVSLPHLAYAVGADDGSAQGADQSVAPTPVSGPVPN
IIVTNFTYGGDSVAAGAKFDLNFTFQNMGQVAVANMVVTVDGGESFAIAGGTNTFYFDAL
WAGYSLSQTVPMQALASAKSGAQPVTVSFRYEYLDSGARSSNQSDVKIAVPISQPDRFEV
GDPVPSDQIVAGQETTVTLEYVNKGKGDIANVEATMEGEGFDATMKTQYVGNVASGATGS
IGYAFTPTASGELNATLKVSYEDSDGQSKTKEFPVKLSVADAAPMDDPSRVDSDMNQNAS
QGLPWWVWAAAAAVAVAVIVGIVLLVRRHRKKKAKSEIDEEWDDWADGNADGKLGTQSGG
DIARGKTVGDAADSTTTNNATASGDATSTSAISPSTDATPTTVIEPVNAAAEPNQIVPDD
SGQSDGSAQTV
Download sequence
Identical sequences A0A133L4E7 F9Y2F9 S3A3S3
gi|476417696|ref|YP_007554394.1| WP_015438549.1.57584 WP_015438549.1.69620 WP_015438549.1.7502 WP_015438549.1.81405 WP_015438549.1.82186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]