SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|387823510|ref|YP_003000997.2| from Escherichia coli BL21(DE3)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387823510|ref|YP_003000997.2|
Domain Number 1 Region: 60-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000968
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387823510|ref|YP_003000997.2|
Sequence length 163
Comment hypothetical protein B21_03247 [Escherichia coli BL21(DE3)]
Sequence
MTKTQINKLIKMMNDLDYPFEAPLKESFIESIIQIEFNSNSTNCLEKLCNEVSILFKNQP
DYLTFLRAMDGFEVNGLRLFSLSIPEPSVKNLFAVNEFYRNNDDFINPDLQERLVIGDDS
ISIFTYDIKSNFFEIRDNIGTENIFSSFSDFSSFLNEIMDSCS
Download sequence
Identical sequences A0A024KR78 C8TY61 C8UHS5
gi|254163369|ref|YP_003046477.1| WP_001467618.1.25843 gi|387823510|ref|YP_003000997.2| gi|387823510|ref|YP_003000997.2| gi|260870170|ref|YP_003236572.1| gi|260846229|ref|YP_003224007.1| gi|260857551|ref|YP_003231442.1| 413997.ECB_03294 573235.ECO26_4532 585395.ECO103_4165 585396.ECO111_4253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]