SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308590|ref|YP_007119567.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308590|ref|YP_007119567.1|
Domain Number 1 Region: 1031-1214
Classification Level Classification E-value
Superfamily Nucleotide cyclase 8.48e-52
Family Adenylyl and guanylyl cyclase catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 653-835
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.6e-46
Family Histidine kinase 0.00061
Further Details:      
 
Domain Number 3 Region: 877-998
Classification Level Classification E-value
Superfamily CheY-like 4.41e-38
Family CheY-related 0.00061
Further Details:      
 
Domain Number 4 Region: 580-663
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.96e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 5 Region: 436-567
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000349
Family PYP-like 0.052
Further Details:      
 
Domain Number 6 Region: 376-426
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000000106
Family HAMP domain 0.0025
Further Details:      
 
Domain Number 7 Region: 143-238
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000432
Family Sensory domain of two-component sensor kinase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428308590|ref|YP_007119567.1|
Sequence length 1286
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MHPPMSRQSLSRLFAKVSGKVPLRTVLIVPFVLQIVGAVGLVGYLSFMNGQKAVNDLATQ
LRSEISNRIDQHLDTYFATPHQINQINSDAIELGLLNLNNFKTTGRYFWKQMQVFQVGYI
SYGNTKGEFIGVERIENGKLLINELSQSNPGKLYIYATDNQGNRTELRQIKDWNPHTEAW
YTDAIKAGKPLWSQIYQWEDQPDIISLSASYPVYDKTKKIVGVLSIDHLLSQISHFLANL
KVSQSGKTFILERNGLLVGSSTSERPFRVVDGKAQRLKALDSKDALIRLTTQYLKDHFGN
LSKINKSQQLNFQIAGQRQFIQVTPWRDQLGLNWLIVVVVPEVDFMGQINANTDTTIALC
LAALVIAIIFCILTARWVTRPILRLNAAAKNLAQGKWEQLIEIERSDELGELAKSFSTMS
GQLKQLFTTLEANNAEMKDLNEALHESENRLAQFLDAVPVGVTVHDATGKICYANTTAQS
ILGRGIISEESPAQLAEVYQIYLADTDQLCPLERLPALRALNGESLTIDDLVIHREEKIV
PVEASATPIFDEKGAIAYAIVAFTDITKRKQSEAERIHFTEELELKNQALQHLDELKDEF
LANTSHELRTPLNGMIGIAESMLDGATGELSELQQKNLLLIAQSGRRLAALVNDILDFSK
LKHKTIELQLKPIGMREIVEVVLNLSQPLIKNKNLQLINAIPPNLTPAEADENRLQQILY
NLVGNAIKFTDTGIVEISANLQVGEEKIEMGNTGIHSLRRPQIQITVSDTGIGIPEDKLD
RIFESFEQADGSTAREYGGTGLGLAVTKKLVELHGGSIHVESTVGVGSRFTFTLTAALGQ
SSELNNLSYSSCLLPAISKLNQEESIQPLQITQEDQGQQFQIMIVDDEPVNLQVLINHLS
LQNYAITQASNGIDALAMIEQGFKPDIVLLDVMMPRMTGYEVCQKLREKFPAYELPVVML
TAKNQVTDLVEGFSVGANDYLSKPISKNELLARIKTHLILSNLAVAYGRFVPHQFLHLLN
KESIIDVQLGDHIQKKMSILFSDIRSFTTLSESMKPEDTFKFINAYLSRMESVIVENQGF
IDKYIGDGIMALFSGSADDAVKAGITMLHRLTEYNQHRANSGYIPVRIGIGINTGSLMLG
TVGGKNRMDGTVISDAVNIASRLETLTKYYGVSLLISHHTLANLQHPTNYRIRFIEQVKV
KGKSQAVAVFEVFDGDEPEIQKGKLATKMTFEQAVWLYNLGLKNEAAQLLKGVLNVNPRD
RVAQIYLERCQSRVSYEGDEHSTPLG
Download sequence
Identical sequences K9W8N1
gi|428308590|ref|YP_007119567.1| WP_015180325.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]