SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308619|ref|YP_007119596.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308619|ref|YP_007119596.1|
Domain Number 1 Region: 706-878
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-58
Family GAF domain 0.0000551
Further Details:      
 
Domain Number 2 Region: 949-1124
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.68e-37
Family Histidine kinase 0.00087
Further Details:      
 
Domain Number 3 Region: 553-696
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-25
Family Heme-binding PAS domain 0.025
Further Details:      
 
Domain Number 4 Region: 204-311
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.58e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.079
Further Details:      
 
Domain Number 5 Region: 26-168
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-24
Family GAF domain 0.08
Further Details:      
 
Domain Number 6 Region: 429-554
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.38e-22
Family Heme-binding PAS domain 0.027
Further Details:      
 
Domain Number 7 Region: 880-957
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.87e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0036
Further Details:      
 
Domain Number 8 Region: 304-417
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.77e-16
Family Heme-binding PAS domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428308619|ref|YP_007119596.1|
Sequence length 1133
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKAPVPTHETARLEALSQYNILDTAPEEAFDDFTCLAAQICETPIALITLVDHHRQWVKS
KIGWTVSETSREISFCAHTILGTEILVVQDAWADERFVTNPLVTAEPHVRFYAGAPLITA
AGYALGSLCVIDYVPRELSPQQLSALQTLSRQVMTQLELKRTVAELAQTKQQSQQLIKLT
YDIREYQQAQEERNALQGALQGFFNLSLDLLCIAGLDGYFKHLNPAYEKTLGYSREELQS
QPFLNFVHPDDKAATLAEVQKLTRGAPTIYLENRYRCKDGSYKWLAWTAFPHVKDGLLYC
VARDITQLKQAEQERLQLLHREQAAHNQITKILESITDAFFALDGEWRFTYVNQQAERLL
QRKRSELLGQSVWDEFPEAVTSLFYQEYHRAVTEEVSVEFEAFYPPLKTWFSVHAYPGKQ
GLSVYFEDINQRKQAQESLQSSEERYRLLFENNPQPMWVNDLETLAIVAVNEAAINHYGY
SREEFLAMTIADIRPAADIPALLENMANVTPGLNKKGVWRHRKKDGSLIEVEITTYSLTF
VGRQAQLVLANDVTERRRAEKALIETTQFQRAILDSANYAIISTTPDGIIRTFNAAAQRL
LGYTAEEVVGKVTPLVIHDYAEVVQRAQELSEELGFWVEPGFESFVAKTRLGKIDEREWT
YIRKDGSRFPVLLSITAVRDLEGNITGFLGIGHDITECQQAEAELQRQHRRSQLFTEITL
KIRQSLQLEDILQTTVTEVQKILQVDRVLIYRVWPDGKGCTVTEAVQPGWPAILGMSFAE
EVFPLKYQELYRQGQVHAIADVEQAYAEMTPCLLEFLHPWGVKAKLVVPILLSGQLWGLL
IAHHCTHPRPWTSFETELLQQLSEQIGLALAQAQLLERETRQRLELARSNAELQEFAYVA
SHDLQEPLRKIQAFGDRLKVKYSEVLTEQGRDYLKRMQNAAERMQALINDLLTLSRVTTR
AQPFVTTKLTQVLQEVLSDLEVSIQQANGRIEVGELPILEADPIQMRQLLQNLIGNALKF
YRQEEPPIIKIYSQQLTDWERQPTQGLNRIERCQIFIEDNGIGFDEKYLDRIFNAFQRLH
GRSEYEGTGMGLAICRKIVERHDGTITAQSSPNLGATFIITLPLQQRQGDRAK
Download sequence
Identical sequences K9W741
WP_015180354.1.75295 gi|428308619|ref|YP_007119596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]