SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308622|ref|YP_007119599.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308622|ref|YP_007119599.1|
Domain Number 1 Region: 474-568,603-675
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-44
Family Histidine kinase 0.00036
Further Details:      
 
Domain Number 2 Region: 843-913,942-988
Classification Level Classification E-value
Superfamily CheY-like 6.4e-32
Family CheY-related 0.031
Further Details:      
 
Domain Number 3 Region: 696-818
Classification Level Classification E-value
Superfamily CheY-like 2.13e-26
Family CheY-related 0.0075
Further Details:      
 
Domain Number 4 Region: 1033-1153
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 4.19e-23
Family Phosphorelay protein-like 0.028
Further Details:      
 
Domain Number 5 Region: 405-486
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 9.42e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 
Domain Number 6 Region: 128-250
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000054
Family GAF domain 0.03
Further Details:      
 
Weak hits

Sequence:  gi|428308622|ref|YP_007119599.1|
Domain Number - Region: 263-384
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00105
Family Heme-binding PAS domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428308622|ref|YP_007119599.1|
Sequence length 1157
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MSWLQLRPPDGLPTFRPLLFALTLVLSGWVCHDGWAPMQILTLLGWLGFTLLPLRLGQVI
PLVGLGTLLVGLLHGDGVNAVRPSLEFGIAAGLGIGLRQFLLGLEWRLASQSVLATLTHT
DTTDTSNTLIDQAVALLRDIVCADAAIAVRRLDEVTAQALVCLPPKALPDPLTTPTLFEE
ATRENRCLYYSNYPATPSASHVLLAQGIQSLAVVPLTLSDGREGAILLLWQRRTDFPSHL
QDFIESLRGELRTLLSFSDTTLRLDKLQARFSSMLQTIHQGVVFIDESGEQGWLNQSAAN
QLELSPGAVEPPMLAQAMAMLRTRADNQTEIVAQAAQFFSQPQAEIRNWNWIFSQPQPKV
LSISSTPTRVRDVPGRLWILDDITEPYLAQLELVASSQELSQTNQQLEKAKAESEEATRI
KSQFLANMSHEIRTPMNAIIGMTGLLLTTELTPQQRDFVTTAQSSSEALLALINDILDLS
KIESGSVELEKQAFNLQSCIEESLDILALKAAEKGIELAYGMHPQTPSIIVGDVTRLRQI
LVNLVSNAVKFTQTGEVVVSVTAKELEGDKGDKGDKGDKGDKGEKILYTNETCYNLQPAT
KFEFQFAVKDTGIGIPPDRIDRLFKSFSQVDASTTRKYGGTGLGLAIGKQLSEMMGGRMW
VESQVNRGSTFYFTLVAAATADSSPMNSDNFPPQFQGKRLLIVDDNDTYRQILTQQLQSW
GMLIYGAASAAEAFDWLNQGQPLDMALLDMQMPGMDGLTLATKIRSYSNYQTLPLVLLTS
INGLERANQTHVPVDLAAFLTKPIKQSQLDSVLNQILAGSSISVNPLPVTLPENPLQLAT
QLPLRILLAEDNGVNQKVALHLLKRIGYQADVVSNGLEVLDAVKRKSYDVVLMDVQMPLM
DGLTATRCICQELSGDGEFGEANQNSQNSDRNQPSKPATSHKRPRIIAMTANAMQGDREE
CLNAGMDDYLCKPISLKALIQALSHCQPLPDREIENWGLSESYVGSPGKGNPKTTLEGDG
EMREFSPLKATNLNPPSSSEPIEAKVLQSFREMAGDMADLVLVEMIDCYLEDAPKLLSAI
AQAIVQNDAVQLRSSAHNLKASSATLGAITLSNVCRKLEVMSRIGNTEYGVDKLPQLEAE
YERVKVALQLERQNAQK
Download sequence
Identical sequences K9W7K6
WP_015180357.1.75295 gi|428308622|ref|YP_007119599.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]