SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308624|ref|YP_007119601.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308624|ref|YP_007119601.1|
Domain Number 1 Region: 323-492
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.98e-41
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 512-629
Classification Level Classification E-value
Superfamily CheY-like 4.41e-32
Family CheY-related 0.0033
Further Details:      
 
Domain Number 3 Region: 4-158
Classification Level Classification E-value
Superfamily CheY-like 1.24e-26
Family CheY-related 0.0026
Further Details:      
 
Domain Number 4 Region: 126-247
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-20
Family Heme-binding PAS domain 0.068
Further Details:      
 
Domain Number 5 Region: 259-325
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000412
Family Homodimeric domain of signal transducing histidine kinase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308624|ref|YP_007119601.1|
Sequence length 631
Comment PAS/PAC sensor hybrid histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MDNHPVRILLVDDDEDDYILTRDLLSESQGTRFEVEWASDWDCALDVMGKNQHDIYLLDY
RLGEHNGLELLQQAVAQGCRAPMILLTGQGDREIDIEAMKAGAADYLDKSQLRAPLLERS
IRYAIERKRAEQKIREQAALLDIATDAILVQNLQNQILFWNQGAQRMYGWKAEEVLGRDA
NQLLCTPENCLRLKEVQTLVALEGNWYGELQQVTQDGKAIIVESRWTLVQNEQEQPTSIL
IVNTDITEKKQLEAQFLRAQRMESIGTLASGIAHDLNNVLAPILMSVQLLALKLHDEQAR
QWLKILEDNARRGAELVKQVVSFARGVKGDRTLVQVRHIISEIRQIAKETFPKSIEVHTD
LAPDLWTVSADATQLHQVLMNLCVNARDALPDGGTLGISAQNLFLNEQSARMNIDAKAGS
YIVITISDTGTGIPPEILDRIFEPFFTTKEVGKGTGLGLSTVIGIVKSHGGFVNVVSKLG
QGTEFEVYLPALKETPIPISEDAEMPRGHGEVILVVDDEAAIRQITQTSLETYAYKVLTA
SDGIEALAVYAQHKEDINVVLIDMMMPVMDGPTTIRTLRRMNPQGKIVAVTGLVSDEKLA
QARDLGVQTFLYKPYTAKELLKTLNAVLRSP
Download sequence
Identical sequences K9W745
WP_015180359.1.75295 gi|428308624|ref|YP_007119601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]