SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308630|ref|YP_007119607.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308630|ref|YP_007119607.1|
Domain Number 1 Region: 533-711
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.94e-41
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 462-545
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.84e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 3 Region: 734-853
Classification Level Classification E-value
Superfamily CheY-like 1.71e-19
Family CheY-related 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|428308630|ref|YP_007119607.1|
Domain Number - Region: 13-61
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00563
Family CBS-domain pair 0.012
Further Details:      
 
Domain Number - Region: 1161-1235
Classification Level Classification E-value
Superfamily CheY-like 0.0384
Family CheY-related 0.015
Further Details:      
 
Domain Number - Region: 896-931
Classification Level Classification E-value
Superfamily CheY-like 0.0712
Family CheY-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308630|ref|YP_007119607.1|
Sequence length 1297
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MPTPSLKEFAQATPVCSQTSGLADLLEIFSSSGCHAIVVVSPEHCPLGVVNLPKVMPHLL
GARQSGDFPLTMTTRDGDRPICELEPPIIEPLAILPAQLSLSQFWPYLQESEESLTPNWG
GWVQGSQSLSKSLSRPAPQEWAGCSPEGRDRDIHPRTQRGFHNSYGDSPPERTTRYANIP
LNSHRFTPEPVPCCDQCQSSPQHWALVDEQGKFSGLLNSWRLLKSLAPNTTQPETTNRDK
QPQPTNLKPLVQLLEHLPLPLSIQTTTGQVLAQNLIWRQQIGTSPNLDWVRRTTAAMLDF
SSNEPCSTRESVSRPDGVTTLANAANQASCESLLPAPRGVKERGKRAEQAGIQSFCAMDT
PRLTTTVSTQQVILSAPVMSQTQESSMVGQASSQTPEALKNSQERVFSFVKIPLSSAVFE
GEKAQAWEDLSNPNSSSYPSSISDLCVVLAQDTTEQQQVTKELAAKNADLIHLNRLKDEF
LACISHELKTPLTAVLGLSTLLKDQALGELNERQARYARLIYQSGRQLMTLVNDILDLTR
METGQLELSCEPVQIQSVCDRAYSQAGQLHQEKEQQEDPTTETQFTLEIEPGLDTLVADE
LRLRQMLVHLLSNALKFTDVGGKMGLRVNRWEGWIAFTVWDTGIGIPPEKQHLIFQKFQQ
LEQPLTRRFEGTGLGLVLTQRLARLHGGDVSFISKPGEGSQFTLLLPPCPPQSRGVDGEI
YTCPSPHAQCPIRNRLVLIVETVPRYLDSLTEQLKSLGYRVVIARSGTEAIEKARGLQPC
AILLNPLLPQLSGWDVLTLLKSDAQTRHIPVLVTATQAEKQQAYQNKADGFLSLPVQKPA
LLQSLTGLEQQERPTTSSKGLTILHLSPVEMYPQTPVDLPASSDSSNLSSGITELLSLQH
SDLNYRVLEADDLEQAELLARVWQPDVVLLNAAKIADSLSYLEQFSLYPGLLSIPLVTLD
HQTTEAANQVTGLSVYPCLAPDNASKITALLQVLQVAAGISYMPSILVMDIGEQGVTQVD
DHSLSQIAPWQDSSINPLAFSASGCAGSHGEIVLEPLGSVRRDLSQSGAKGLQHEVPQRT
SADSYALSSGGQEALPCQTFQQCFQGTGGSVSHVEREMGGMHNRVTPQELHRLPVRQSRR
VRSAGGKGRYSQTATPLKPQSSWLQALMQYLQTAGFRSVLSGSWTEIYHQLQEQSVDLLL
IRIKDISDASGLVSGLLALTQLQKQKLPPILVLDHRLNSDSQAVGARLSPRNQGMIGRVD
STSTLDSVLTAVATQILRGNALSMTQLLEQINQALGM
Download sequence
Identical sequences K9W8R9
gi|428308630|ref|YP_007119607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]