SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308631|ref|YP_007119608.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308631|ref|YP_007119608.1|
Domain Number 1 Region: 199-304
Classification Level Classification E-value
Superfamily KaiA/RbsU domain 4.45e-50
Family Circadian clock protein KaiA, C-terminal domain 0.0000244
Further Details:      
 
Domain Number 2 Region: 1-151
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000000124
Family N-terminal domain of the circadian clock protein KaiA 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308631|ref|YP_007119608.1|
Sequence length 305
Comment KaiA domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPPQLTVCTFVNSEPLAQSLSQILSGDRYIWLAACSESDFFDVIEQHKHQIDCLVLEDDG
SLKNVTHRLSEQGTLLPVVILPQESKVISFHATTNQSLPPAQKNNNSSSAQTNPLFHAAE
VRLHFSQLPELSGFIDKAIAQFVTLSPVSSLPDLFTTDEIATELSHRSFLLQQQRRLSEK
LKERLGYLGVYYKRNPQLFLRHLPPSERQKILENLKSEYRQIVLKYFSQDNTLNQRIDNF
VDKSFFADISVSRIVEIHMELMEEFSKQLKLEGRSEDILLDYRLTLIDVIAHLGEMYRRS
IPRES
Download sequence
Identical sequences K9W9N0
gi|428308631|ref|YP_007119608.1| WP_015180366.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]