SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308699|ref|YP_007119676.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308699|ref|YP_007119676.1|
Domain Number 1 Region: 661-829
Classification Level Classification E-value
Superfamily GAF domain-like 8.72e-62
Family GAF domain 0.00026
Further Details:      
 
Domain Number 2 Region: 457-626
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-57
Family GAF domain 0.00018
Further Details:      
 
Domain Number 3 Region: 279-446
Classification Level Classification E-value
Superfamily GAF domain-like 2.07e-55
Family GAF domain 0.00043
Further Details:      
 
Domain Number 4 Region: 877-1177
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 8.63e-52
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000454
Further Details:      
 
Domain Number 5 Region: 13-74
Classification Level Classification E-value
Superfamily TPR-like 0.000000268
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Weak hits

Sequence:  gi|428308699|ref|YP_007119676.1|
Domain Number - Region: 224-269
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000157
Family HAMP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308699|ref|YP_007119676.1|
Sequence length 1182
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MKNQLDQALAKTHSQGQYEAAIQPFSDLATQQPQDAKIRIWLGAASREAGDLDKARAELR
EALRLAGDSATADLARTALVQLENESSGSPSHPPIASQGSHSPLGQLSVPQVFTSTLKNP
PFSIALSSQSPQQSSPPWWRQLRLSTKAILLAIAFGTLPAIGIGATSYYLTNQAITTQVA
QTGQSPTTTMSELKAQLLLTLMLGTGGTVLLVGAIAAFLSHRASREISAATNAVEKLGRG
ELNTYLKVQGEDELSTLSTHINQLADQLQLQFSQQAAEVKQELLLNSISSSIREAFDTQD
MFTTVVAEVRAALKADRVIVYRFNPDWNGTMIAESVGRGWPPSLGAQINDTCFKDRYVIP
YQKGRIRATNDIYNAGLTDCHIRQLETFSVKANLVVPIIADRQLHGLLITHQCSGSRTWK
ETEIDFLKQVATQMGFALNQEILLKKEETLRKQQEAEAERARLLNDITSNIRESLDTDYI
FNTAVVETRAALQADRVVVYRFESEGHGMVVAESVARGWPSALGLQMANPCFENRYVILY
EKGRVKANEDISKADLSDCHLRQLETLSVKANLIVPIIVDRQLHGLLIAHQCSAPRTWKE
IEIDFFKQVANQVGVALDQAMLLKQQETLRKQKEAEAERARLLAEAAEMAALEQRQQKEA
EAKRARAFAEMTKQILRSLNLEDIFSTTVRQVKQALKADRVLIYRFDSDWSGTMIAESVD
SNWTIALGAEVEDTCFKGNHGGLYRKGRVRAINDIYQANLTKCHIKLLERFEVKANLVAP
ILIRDELLGLLIAHQCAKPRDWQEEEINWLAQVATQVGIAIEQATLLEQREQARQEAQAS
FQEQRQQKEALQRQLAELLNEVKGAAKGDLTVLAEVKEGEIGTVADFFNSIIASLRGIVT
QVKQAAVQVNVSLGENEGAIRQLSDQALTQAEEITRTLGSVEQMTLSIQAVAESAHRAAA
VARSASTTAQAGGQAMERTVQGILKLRATVGETSKKVKRLGQSSQEISKAVYLIQQIAQA
TNMLALNAGIQTARENEDAQSFTAVAEEISELAERSTAATQEIEHIVETIQRETNEVVEA
MELGTSQVVEGTYLVEETKDSLGQILEVSHQIDELVQSISSATVSQAQTSLAVTNLMQKI
ARVSERTSESSHQISRSLQQTVAVAQELQSSVGVFKVDTDHS
Download sequence
Identical sequences K9W7A6
WP_015180434.1.75295 gi|428308699|ref|YP_007119676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]