SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308711|ref|YP_007119688.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308711|ref|YP_007119688.1|
Domain Number 1 Region: 9-337
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2e-119
Family TK-like PP module 0.000000000635
Further Details:      
 
Domain Number 2 Region: 341-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.88e-66
Family TK-like Pyr module 0.000000218
Further Details:      
 
Domain Number 3 Region: 538-670
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.95e-44
Family Transketolase C-terminal domain-like 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308711|ref|YP_007119688.1|
Sequence length 670
Comment transketolase [Microcoleus sp. PCC 7113]
Sequence
MAVATQSLEELCINSIRFLAIDAVQKANSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWF
NRDRFVLSAGHGCMLQYALLHLTGYDSVTLDDIKQFRQWGSKTPGHPENFETLGVEVTTG
PLGQGIANGVGLAMAEAHLAAKFNKPDAKIVDHYTYVILGDGCNMEGVSGEACSLAGHLG
LGKLIALYDDNHISIDGSTDVSFTEDVGKRFEAYGWHVQHVEDGNSDLDAIAKAIEAAKA
VTDKPSLIKVTTIIGYGSPNKSNTADVHGAALGKDEVKATRENLGWEYPEFEVPEDALKH
FRKAVERGANLETEWDQALADYKAKYPEEAAEFERFASNKLPEGWEKALPTYTPEDKALA
TRKTSEMTLNALAPVLPELIGGSADLTHSNYTLLKGFGDFQKGQYANRNLRFGVREHGMG
SICNGIALHSSGLIPYCATFLVFADYMRAAIRLSALSQAGVIYVMTHDSIALGEDGPTHQ
PVETIASLRAIPNLLVIRPADGNETSGAYKVAIQAASENRPTLMAFSRQNLPQLAGSGID
HVAKGAYILSDSEGTPDLILIGTGGETYLCVDAAEKLRAEGKNVRVVSMPCWELFDEQDE
AYRESVLPKAVTKRLAVEAASSFGWCRYLGNEGAMISIDRFGVSAPGGVALEKFGFTVDN
VVAKAKELLG
Download sequence
Identical sequences K9W9U4
WP_015180446.1.75295 gi|428308711|ref|YP_007119688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]