SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308787|ref|YP_007119764.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308787|ref|YP_007119764.1|
Domain Number 1 Region: 1586-1767
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.75e-44
Family Histidine kinase 0.0025
Further Details:      
 
Domain Number 2 Region: 2121-2246
Classification Level Classification E-value
Superfamily CheY-like 1.32e-38
Family CheY-related 0.0027
Further Details:      
 
Domain Number 3 Region: 1250-1423
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-28
Family GAF domain 0.0065
Further Details:      
 
Domain Number 4 Region: 1861-1974
Classification Level Classification E-value
Superfamily CheY-like 1.85e-26
Family CheY-related 0.0011
Further Details:      
 
Domain Number 5 Region: 1982-2107
Classification Level Classification E-value
Superfamily CheY-like 2.13e-21
Family CheY-related 0.0039
Further Details:      
 
Domain Number 6 Region: 1514-1598
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.47e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Domain Number 7 Region: 771-1083
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 2.88e-18
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 
Domain Number 8 Region: 135-444
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 6.54e-18
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 
Domain Number 9 Region: 587-764
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000000000000915
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.021
Further Details:      
 
Domain Number 10 Region: 1047-1264
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000000000000288
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.011
Further Details:      
 
Domain Number 11 Region: 403-580
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000000000000759
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.024
Further Details:      
 
Weak hits

Sequence:  gi|428308787|ref|YP_007119764.1|
Domain Number - Region: 1406-1519
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0345
Family G proteins 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428308787|ref|YP_007119764.1|
Sequence length 2248
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MPTAQAPQQNTEDLDLKQLLRTLTAVKKGNFSVRMPVEQTGMAGKIADALNDIIERNERM
AAELERISTIVGKEGKITQRASLGNVTGSWSASIDSVNALITDLVQPTAETARVIRAVAK
GDLSQTIATEIEGRPLKGEFLSTAQVVNTMVAQLSSFSSEVTRVAREVGTEGKLGVQAEV
QGVAGTWKDLTDNVNLMAGNLTAQVRNIAEVTTAVANGDLSKKITVDVKGEIFELKNTMN
IMVDQLNSFASEVTRVAREVGTEGKLGVQAEVRGVAGTWKDLTDSVNLMAGNLTAQVRNI
AEVTTAVANGDLSKKITVDVKGEIFELKNTVNIMVDQLNSFASEVTRVAREVGADGKLGG
QAEVRGVAGTWKDLTDSVNFMAGSLTAQVRNIAEVTTAVANGDLSKKITVDVKGEILELK
DTINTMVDQLNSFASEVTRVAREVGTEGKLGVQAEVQGVAGTWKDLTDSVNSMAGNLTGQ
VRNIAEVATAIANGDLSKKITADVKGEILELKNTMNIMVDQLNSFASEVTRVAREVGAEG
KLGGQAEVRGVAGTWKDLTESVNFMAGSLTAQVRNIAEVTTAVANGDLSKKITVDVKGEI
LELKNTMNIMVDQLNSFASEVTRVAREVGSEGKLGVQAEVRGVAGTWKDLTDSVNSMAGN
LTAQVRNIAEVTTAVANGDLSKKITVDVRGEILELKNTINIMVDQLSSFASEVTRVAREV
GTEGKLGVQAEVRGVAGTWKDLTDNVNLMAGNLTGQVRNIAEVATAIANGDLSKKITVQV
KGEILELKNTINIMVDQLSSFASEVTRVAREVGSEGKLGVQADVRGVAGTWKDLTDSVNF
MAGSLTSQVRNIAAVTTAVANGDLSKKITVDVKGEILELKNTVNVMVDQLNSFASEVTRV
AREVGTEGKLGVQAEVKGVAGTWKDLTDSVNFMAGSLTAQVRNIAEVTTAVANGDLSKKI
TVDVKGEILELKNTINTMVDQLNSFASEVTRVAREVGTEGKLGVQAYVRGVGGTWKDLTD
NVNSMAGNLTAQVRNIAEVTKAVANGDLSKKITVDVKGEIFDLKNTINVMVDQLSSFASE
VTRVAREVGTEGKLGGQAHVTGVAGTWKDLTDSVNSMAGNLTAQVRGIAKIVTAVANGDL
KRKLMLDAKGEIETLADTINEMIDTLATFADQVTTVAREVGIEGKLGGQAKVPGAAGTWR
DLTDNVNELAATLTTQLRAIAEVAIAVTKGDLTRSIAVEAQGEVAVLKDNINQMIANLRE
TTQKNTEQDWLKTNLAKFTRMLQGQRDLETVSKLILSELTPLVGAQHGVFYIMDGNETHP
LLKLLSSYAYRERKNLANRFRLGEGLVGQCALEKERILITELPDDYIKISSGLGESSPRN
AVVLPVLFEGMVTAVIELASFRRFNEIHLTFFDQLTESIAIVLNTIAASMRTEELLKQSQ
SLTEELQAQQKELTQTNKRLEQQAQSLKASEELLKSQQEELQQTNEELEERSELLALQNR
EVERKNREIEQARQALEEKAEQLALTSKYKSEFLANMSHELRTPLNSLLILARLLSDNTE
KNLSGKQVEYARTIHSAGTDLLTLINDILDLAKIESGTMGVEIDQMRFSDLATHMERTFR
QVAQDKRLDFSLEFDSSLPRAIYTDSKRLQQVLKNLLANAFKFTAQGQVNLRVTIANHGW
SLTHEVLNRATTVIAFSVSDTGIGIPLDKQKVIFEAFQQADGSTSRKYGGTGLGLSISRE
IARLLGGEITLLSSPGQGSTFTLYLPDSYQGGTDGTVMRGGVVGQGNGWSSAEQVRGEGE
LSRPMLESFSGSMLPQSPVSPSSLLPSSSPAISYLSTSLPQQDGAISIADDRENIQPDDR
VLLIIEDDLKFARILLDMAREQGFKVLVAARSDIGLAMAREYQPDAITLDIQLPGMDGWM
VLDRLKHDPNTRHIPVHILTVEEGRQRGLQLGAIAYLQKPINPDTLLEAISGIKSFVERQ
VKNLLVVEDNETQRQSIIELIGNHDVSTTAVGTGAEALATLKTGLFDCIVLDLGLPDMTG
FELIEQIKQEPGLSKLPIIIYTGQELTRTEETELKRMAETIIIKDVRSPERLLDETALFL
HRVQRDLPEPKQQMLEQLYQSDPVLAGKRVLIVDDDVRNIFALTSMLEHHQMQIFYSENG
RDGLALLQQTPNIDVILMDVMMPEMDGYETTRAIRNISEYASLPIIALTAKAMKGDREKC
IEAGASDYITKPVDSEQLLSLLRVWLYR
Download sequence
Identical sequences K9W804
WP_015180522.1.75295 gi|428308787|ref|YP_007119764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]